DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and end-1

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_506475.1 Gene:end-1 / 179893 WormBaseID:WBGene00001310 Length:221 Species:Caenorhabditis elegans


Alignment Length:110 Identity:32/110 - (29%)
Similarity:49/110 - (44%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   783 EHVSRANSRRLSASKR-----AGLSCS--NCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPL 840
            |::...::.|...:|:     ....||  ||.|..|:||||..:|...||.|.||::.:.:.||.
 Worm   113 ENIPPVSTNRKIVNKKPSTFHTNSVCSNPNCRTRETTLWRRTDSGAIECNGCSLYFRKNGIQRPA 177

  Fly   841 TMKKDTIQKRKRKPKGTKSEKSKSKSKNALNAIMESGSLVTNCHN 885
            .:.:.||.||.|:|:......:...||              .|||
 Worm   178 ELCRKTIMKRNRRPRAEVQSPTPEDSK--------------LCHN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 18/55 (33%)
ZnF_GATA 802..853 CDD:238123 22/52 (42%)
end-1NP_506475.1 GAT1 <80..>221 CDD:227928 32/110 (29%)
ZnF_GATA 137..190 CDD:238123 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.