DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and elt-7

DIOPT Version :10

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_504283.1 Gene:elt-7 / 178868 WormBaseID:WBGene00015981 Length:198 Species:Caenorhabditis elegans


Alignment Length:55 Identity:27/55 - (49%)
Similarity:38/55 - (69%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 CSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTM--KKDTIQKRKRKPK 855
            ||:|.||.|:|||:|..|...||||.|||:.:.|.|||::  :|.|.:||::..|
 Worm   143 CSHCSTTTTTLWRKNDEGNLECNACNLYYRHNKVKRPLSLCKQKPTTRKRRQAKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 802..853 CDD:238123 26/51 (51%)
elt-7NP_504283.1 PRK10263 <9..>92 CDD:236669
ZnF_GATA 143..194 CDD:238123 26/50 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.