DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and elt-7

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_504283.1 Gene:elt-7 / 178868 WormBaseID:WBGene00015981 Length:198 Species:Caenorhabditis elegans


Alignment Length:55 Identity:27/55 - (49%)
Similarity:38/55 - (69%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 CSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTM--KKDTIQKRKRKPK 855
            ||:|.||.|:|||:|..|...||||.|||:.:.|.|||::  :|.|.:||::..|
 Worm   143 CSHCSTTTTTLWRKNDEGNLECNACNLYYRHNKVKRPLSLCKQKPTTRKRRQAKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 23/45 (51%)
ZnF_GATA 802..853 CDD:238123 26/51 (51%)
elt-7NP_504283.1 ZnF_GATA 139..187 CDD:214648 22/43 (51%)
ZnF_GATA 143..194 CDD:238123 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.