DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and GATA5

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_536721.1 Gene:GATA5 / 140628 HGNCID:15802 Length:397 Species:Homo sapiens


Alignment Length:417 Identity:127/417 - (30%)
Similarity:158/417 - (37%) Gaps:129/417 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 QHHNSSSSSPGPAGLHHSSSSAATAAAVAAATAAVNGHNSSLEDGYGSPRSSHSGGGGGGTLPAF 626
            |...:.||:.||...|      ..||....|||....|:.|      .|.|..|.||..|:  |:
Human    66 QTATADSSAFGPGSPH------PPAAHPPGATAFPFAHSPS------GPGSGGSAGGRDGS--AY 116

  Fly   627 QRIAYPNSGSVERYAPITNYRGQNDTWFDPLSYATSSSGQAQLGVGVGAGVVSNVIRNGRAISAA 691
            |....|.    |::|.             ||.....:|..|.....|...|             |
Human   117 QGALLPR----EQFAA-------------PLGRPVGTSYSATYPAYVSPDV-------------A 151

  Fly   692 NAAAAAAADGTTGRVDPG---TFLSASASLSAMAAESGGDFYKPNSFNVGGGGRSKANTSGAASS 753
            .:..|...||:.....||   ||:|              ||.:    ...|.||...| .||.|:
Human   152 QSWTAGPFDGSVLHGLPGRRPTFVS--------------DFLE----EFPGEGRECVN-CGALST 197

  Fly   754 ----------YSCPGSNATSAATSAVASGTAATAATTLDEHVSRAN------SRRLSASKRAGLS 802
                      |.|   ||..                 |...::..|      .:|||:|:||||.
Human   198 PLWRRDGTGHYLC---NACG-----------------LYHKMNGVNRPLVRPQKRLSSSRRAGLC 242

  Fly   803 CSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTMKKDTIQKRKRKPKG-TKSEKSKSKS 866
            |:|||||:|:|||||..|||||||||||.|||.|||||.|||::||.||||||. .|:..|...:
Human   243 CTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKARGSSGST 307

  Fly   867 KNALNAIMESGSLVTNCHNVGVVLDSSQMDVNDDMKPQLDLKPYNSYSSQP----QQQLPQYQQQ 927
            :||    ..|.|.|.:       .|||.  .....||.|         :.|    ....||...|
Human   308 RNA----SASPSAVAS-------TDSSA--ATSKAKPSL---------ASPVCPGPSMAPQASGQ 350

  Fly   928 QQLLMADQHSSAASSPHSMGSTSLSPS 954
            :...:|..|......|......|.:||
Human   351 EDDSLAPGHLEFKFEPEDFAFPSTAPS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 38/48 (79%)
ZnF_GATA 802..853 CDD:238123 38/50 (76%)
GATA5NP_536721.1 GATA-N 1..170 CDD:283099 35/147 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 19/63 (30%)
ZnF_GATA 184..229 CDD:214648 13/65 (20%)
ZnF_GATA 188..232 CDD:238123 10/64 (16%)
ZnF_GATA <253..293 CDD:238123 31/39 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..356 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9610
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1745
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.