DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and Zglp1

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:XP_006242739.1 Gene:Zglp1 / 100360291 RGDID:2322460 Length:326 Species:Rattus norvegicus


Alignment Length:322 Identity:69/322 - (21%)
Similarity:109/322 - (33%) Gaps:71/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 HQHHNSSS----SSPGPAGLHHSSSSAATAAAVAAATAAVNGHNSSLEDGYGSP-------RSSH 614
            |:||...|    ..||..||..:....:||.......||.....:..::....|       |.|.
  Rat    26 HRHHPRLSLILGFIPGGGGLRGAGQRDSTAGPTVGMEAAQARDLTRPQELLAPPCLDTESLRKSR 90

  Fly   615 SGGGGGGTLPAFQRIAYPN--------SGSVERYAPITNYRGQNDTWFDPLSYATSSSGQAQLGV 671
            ......|.|    |...||        ..||....|....: :......| |.||...|.....:
  Rat    91 PPALEPGAL----RCLTPNGRSLWPACQDSVSTALPFLQEK-EKGLPGSP-SPATQVLGSCWELM 149

  Fly   672 GVGAGVVSNVIRNGRAISAANAAAAAAADGTTGRVDPGTFLSASASLSAMAAESGG---DF-YKP 732
            .:|.....::.||.::....|...::|....:.:..|...|:....:..:.....|   :| .:|
  Rat   150 VIGMSDHLSMARNPKSTQCPNLETSSATSPASLQRRPRKQLNPRMGIEKVDPRFKGVTLEFQIQP 214

  Fly   733 NSFNVGGGGRSKANTSGAASSYSCPGSNATSAATSAVASGTAATAATTLDEHVSRANSRRLSASK 797
            :|            :.....:||.||.:.:....::.:...|:..:|      .....||     
  Rat   215 DS------------SLQIVPTYSLPGRSCSQKLPTSPSKALASPGST------EALGPRR----- 256

  Fly   798 RAGLSCSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHS--------VPRPLTMKKDTIQKRK 851
                 |::|.|..|.|||....|.|:|||||:.||.:.        |||      .:||.|:
  Rat   257 -----CASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPR------KSIQPRR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 19/56 (34%)
ZnF_GATA 802..853 CDD:238123 22/58 (38%)
Zglp1XP_006242739.1 ZnF_GATA 254..>291 CDD:214648 18/46 (39%)
GATA 257..291 CDD:278735 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.