DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and ZGLP1

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_001096637.1 Gene:ZGLP1 / 100125288 HGNCID:37245 Length:271 Species:Homo sapiens


Alignment Length:165 Identity:45/165 - (27%)
Similarity:61/165 - (36%) Gaps:49/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 TGRVDPGTFLSASASLSAMAAESGGDFYKPNSFNVGGGGRSKANTSGAASSYSCPGSNATSAATS 767
            |.||||| |...:....          .||:|            :.....:||.|.|:.:..:.:
Human   137 TERVDPG-FEGVTLKFQ----------IKPDS------------SLQIIPTYSLPCSSRSQESPA 178

  Fly   768 AVASGTAATAATTLDEHVSRANSRRLSASKRAGLSCSNCHTTHTSLWRRNPAGEPVCNACGLYYK 832
            ....|.||....| :.|  .|.|..|...:     |::|.|..|.|||....|.|:|||||:.||
Human   179 DAVGGPAAHPGGT-EAH--SAGSEALEPRR-----CASCRTQRTPLWRDAEDGTPLCNACGIRYK 235

  Fly   833 LHS--------VPRPLTMKK----------DTIQK 849
            .:.        |||.....|          |.||:
Human   236 KYGTRCSSCWLVPRKNVQPKRLCGRCGVSLDPIQE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 21/66 (32%)
ZnF_GATA 802..853 CDD:238123 23/66 (35%)
ZGLP1NP_001096637.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..141 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 7/31 (23%)
ZnF_GATA 202..>240 CDD:214648 16/42 (38%)
GATA 206..240 CDD:278735 16/33 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.