DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel89B and SMARCA5

DIOPT Version :9

Sequence 1:NP_001287351.1 Gene:Hel89B / 41943 FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_003592.3 Gene:SMARCA5 / 8467 HGNCID:11101 Length:1052 Species:Homo sapiens


Alignment Length:656 Identity:206/656 - (31%)
Similarity:303/656 - (46%) Gaps:98/656 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1290 LLSTHCFANLVQLMPLDGKTEQLKSDPLQARKTRDREFLDYLFNPKSIPNYK------------- 1341
            |..|..||:.:|  |...||   .:.||:.:..|.|...|...|..|:.:|:             
Human    96 LKQTELFAHFIQ--PAAQKT---PTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELL 155

  Fly  1342 -------------VPVPISV---ELRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICILA 1390
                         ...|..|   :||.||..|:|||..|.:..::|||.|:||||||||||.:|.
Human   156 TESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLG 220

  Fly  1391 GDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDI--GT 1453
            ....:|....    |.:|:.|.:...:|:.|.::::   ..||.:...|....|.....|:  ..
Human   221 YMKHYRNIPG----PHMVLVPKSTLHNWMSEFKRWV---PTLRSVCLIGDKEQRAAFVRDVLLPG 278

  Fly  1454 KCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNN 1518
            :.::.|.||:.:.|:...|...::.|.|:||.|.|||.|:|.|:.::..|..:||:|:|||:|||
Human   279 EWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNN 343

  Fly  1519 VLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVLAMEALHRQVLPFLLRRV 1583
            :.|||||.:||:|....:...|...|        |..:...:|:    .:|.||..:.||||||:
Human   344 LHELWSLLNFLLPDVFNSADDFDSWF--------DTNNCLGDQK----LVERLHMVLRPFLLRRI 396

  Fly  1584 KEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQA 1648
            |.||.|.||||....:...||.:|...|.....|.: |.|:..|...           |..:...
Human   397 KADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDI-DILNSAGKMD-----------KMRLLNI 449

  Fly  1649 LRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDIEHSAKLPALKQLLLDCGIGVQTESVSQ 1713
            |..|:..||||.| ...:|.....|:.:.|..:|...:.....||.||:              ..
Human   450 LMQLRKCCNHPYL-FDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKE--------------QG 499

  Fly  1714 HRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSID-VLLLTTMV 1777
            .|.|||.|:..:|||:|...:.|   :..|.||||..|..:|||.:|.:|...|.. |.:|:|..
Human   500 SRVLIFSQMTRVLDILEDYCMWR---NYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRA 561

  Fly  1778 GGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKIL 1842
            ||||:||..||.||..:.||||..|||||||||||||.|.|.|:|.||.|::||:|:...:.|:.
Human   562 GGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLR 626

  Fly  1843 TANTVVS---AENASLQTMGTSQIFDLFNGG-----KDKGAESGSSAVQGTASGG----MSMNTI 1895
            ..:.|:.   ..:.:|..:|..::..:...|     ..|.:|.....:.|....|    ..||..
Human   627 LDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEK 691

  Fly  1896 IENLPE 1901
            :..:.|
Human   692 LSKMGE 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787 3/7 (43%)
SNF2_N 1353..1662 CDD:278600 103/310 (33%)
DEXDc 1370..1514 CDD:238005 47/145 (32%)
Helicase_C 1689..1813 CDD:278689 53/124 (43%)
SMARCA5NP_003592.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
PLN03142 69..1012 CDD:215601 206/656 (31%)
DEAH box 308..311 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.