DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5516 and Zcchc10

DIOPT Version :9

Sequence 1:NP_001189228.1 Gene:CG5516 / 41940 FlyBaseID:FBgn0038389 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_080755.2 Gene:Zcchc10 / 67966 MGIID:1196228 Length:178 Species:Mus musculus


Alignment Length:182 Identity:77/182 - (42%)
Similarity:105/182 - (57%) Gaps:38/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKLAQKKRSAKQAADFPNGIRCQKCLQIGHWSYECKEKRKYVHRSSRTKQLSKRMSQKEADAPKN 73
            |.:|::|..|.:     ..:||||||:.|||:||||.||||:||.|||.:|.|.:.:||     |
Mouse     7 RLIARRKAEANK-----QHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE-----N 61

  Fly    74 QVEEHSEVASSEGKKVRRKRKTSKSSSSSSSSSDSSDSSSESGSSSESDSSSSSSDSDDEE---- 134
            ::...|...::..||:::|:::...:|||:|||||  |:|||.|.||:.:||||.|||.:|    
Mouse    62 RLLLQSIGETNIEKKIKKKKRSKSVTSSSTSSSDS--SASESSSESETSASSSSEDSDSDESLSS 124

  Fly   135 ------------GSSSDSSGSGSDSD----------SSEDQKQGAPQKKKKR 164
                        .|||.||.|.||||          |||......||||||:
Mouse   125 SSSSSSSSACSSSSSSSSSSSSSDSDSSSSSSSSSSSSESSSDDEPQKKKKK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5516NP_001189228.1 zf-CCHC_3 27..59 CDD:290628 22/31 (71%)
Zcchc10NP_080755.2 zf-CCHC_3 17..56 CDD:290628 24/43 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..178 46/113 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849385
Domainoid 1 1.000 61 1.000 Domainoid score I10466
eggNOG 1 0.900 - - E1_KOG3116
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4698
Isobase 1 0.950 - 0 Normalized mean entropy S6420
OMA 1 1.010 - - QHG54889
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006615
OrthoInspector 1 1.000 - - oto95303
orthoMCL 1 0.900 - - OOG6_104907
Panther 1 1.100 - - LDO PTHR13491
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5402
SonicParanoid 1 1.000 - - X5618
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.