DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5516 and ZCCHC10

DIOPT Version :9

Sequence 1:NP_001189228.1 Gene:CG5516 / 41940 FlyBaseID:FBgn0038389 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001295056.1 Gene:ZCCHC10 / 54819 HGNCID:25954 Length:202 Species:Homo sapiens


Alignment Length:150 Identity:66/150 - (44%)
Similarity:90/150 - (60%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IRCQKCLQIGHWSYECKEKRKYVHRSSRTKQLSKRMSQKEADAPKNQVEEHSEVASS--EGKKVR 90
            :||||||:.|||:|||..||||:||.|||.:|.|.:.:||     |::.....:..:  |.|..:
Human    53 VRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKE-----NRLLLQQSIGETNVERKAKK 112

  Fly    91 RKRKTSKSSSSSSSSSDSSDSSSESGSSSESDSSSSSSDSDDEEGSSSDSSGSGSDSDSSEDQKQ 155
            ::.|:..|||||||.|.:||||||   |.|:.:||||.|||.:|.|||.||.:.|.:.||.....
Human   113 KRSKSVTSSSSSSSDSSASDSSSE---SEETSTSSSSEDSDTDESSSSSSSSASSTTSSSSSDSD 174

  Fly   156 GAPQKKKKRAGSSPESSDDQ 175
            .........:.|:..||||:
Human   175 SDSSSSSSSSTSTDSSSDDE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5516NP_001189228.1 zf-CCHC_3 27..59 CDD:290628 21/30 (70%)
ZCCHC10NP_001295056.1 zf-CCHC_3 49..88 CDD:290628 23/34 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159003
Domainoid 1 1.000 59 1.000 Domainoid score I10711
eggNOG 1 0.900 - - E1_KOG3116
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4772
Isobase 1 0.950 - 0 Normalized mean entropy S6420
OMA 1 1.010 - - QHG54889
OrthoDB 1 1.010 - - D1638633at2759
OrthoFinder 1 1.000 - - FOG0006615
OrthoInspector 1 1.000 - - oto91721
orthoMCL 1 0.900 - - OOG6_104907
Panther 1 1.100 - - LDO PTHR13491
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5402
SonicParanoid 1 1.000 - - X5618
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.880

Return to query results.
Submit another query.