DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5516 and CG15784

DIOPT Version :9

Sequence 1:NP_001189228.1 Gene:CG5516 / 41940 FlyBaseID:FBgn0038389 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001284891.1 Gene:CG15784 / 31461 FlyBaseID:FBgn0029766 Length:554 Species:Drosophila melanogaster


Alignment Length:128 Identity:33/128 - (25%)
Similarity:62/128 - (48%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AARKLAQKKRSAKQAADFPNGIRCQKCLQIGHWSYECKEKRKYVHRSSRTKQLSKRMSQKEADAP 71
            |.:|:.:.:|..:||           .:.:......|:::.: ...:.|||:..|:.::|:....
  Fly    56 ALKKVTKVQRMLEQA-----------MILLAEEEARCRQQEQ-EQGTKRTKKQLKKKAKKDKKKA 108

  Fly    72 KNQVEEHSEVASSEGKKVRRKRKTSKSSSSSSSSSDSSDSSSESGSSSESDSSSSSSDSDDEE 134
            |...::.:            |::..:.:::....|::|.|||.|.|||.|.||||||.|:|||
  Fly   109 KKLAKQQA------------KKQAEEQTAAGEEPSNTSSSSSSSSSSSSSSSSSSSSSSEDEE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5516NP_001189228.1 zf-CCHC_3 27..59 CDD:290628 4/31 (13%)
CG15784NP_001284891.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13491
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.