DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap47 and AT1G03350

DIOPT Version :9

Sequence 1:NP_001356918.1 Gene:Sap47 / 41938 FlyBaseID:FBgn0013334 Length:551 Species:Drosophila melanogaster
Sequence 2:NP_563683.1 Gene:AT1G03350 / 838679 AraportID:AT1G03350 Length:470 Species:Arabidopsis thaliana


Alignment Length:421 Identity:99/421 - (23%)
Similarity:162/421 - (38%) Gaps:108/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GTPTGDEGQIGQGK-----------GDEV-KITTKVTQQAKHFGSFLSSAISKAGSKIKETVKDN 221
            ||....|.::.||.           |:.| |.|.::..|.|       .||..||::...:  ||
plant    77 GTGLKKEIEVAQGSLGTVGHAIDELGNTVLKGTAEIIAQGK-------EAILAAGNESDSS--DN 132

  Fly   222 TILDSFNKEQEAFIKGQGGVGNGAAPWIGHANEAKIKEEILGLSQDRRNFVRAPPAGVDFE---- 282
            ....||.: :::|         .:.|:      ::...:|..:..|...:...|....|::    
plant   133 NSSQSFGR-RDSF---------SSKPY------SRFDAQIRAVQGDLNTYCEEPEDSDDYKKWES 181

  Fly   283 -FSYDTAYPTAIAIMAEDKALETMRFELVPKIITEENFWRNYFYRVSLIIQAAELGTLGADGVGQ 346
             ||.|........::.|:..::.:...:||.::..|.||..|||||:.:.||.:   |.|:.|.:
plant   182 AFSLDGKAEEMEKLLEENGDMKGVYKRVVPSMVDHETFWFRYFYRVNKLKQAED---LRANLVKR 243

  Fly   347 ASSGEDANEVA-----TKEKKSKTAEPAK---------------GDSS--VKAIAEQPKAVIEPE 389
            |.|.:|..|::     .:|...|..|..|               ||.|  ||...|...:|.:..
plant   244 AISLDDEEELSWDIDDEEESSEKVVEATKDVSRLKLEGNDGMGGGDVSETVKDEVESTYSVAKVS 308

  Fly   390 AQECDVQAAKS---------KAKAKAQAGKELGQK--ISESEFVSDDFQASSE----------SD 433
            .|: :|.:|.|         |....::..||...:  ..|..||.....||.|          ||
plant   309 TQD-EVTSADSVTEVSNVGLKTDKDSEEKKETDSEEVPEEKSFVDAAPPASDEAPIQDSVKPTSD 372

  Fly   434 LAEIQDGMRKLGIDSMTQQ-------ALAATDEEQWEKDLE-AELKDYEVVDEGGTGGDGGGGR- 489
            .|.|||.::....::...|       |.:::.::..|:||. .|::|...:|...|...||... 
plant   373 EAPIQDSVKPKSDEAAPSQDSAKPDVAASSSTQQPSEEDLGWDEIEDMSSIDGKETSRSGGSPNR 437

  Fly   490 ---RKGRKAGEDD-------TEADEDEPTIS 510
               ||...|.|:|       .|.||:|.:.|
plant   438 AELRKRLSAAEEDEDLSWDIDEDDEEESSSS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap47NP_001356918.1 BSD 281..331 CDD:128990 14/54 (26%)
AT1G03350NP_563683.1 BSD 181..231 CDD:128990 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16019
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.