DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and PAM16

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_012431.1 Gene:PAM16 / 853340 SGDID:S000003640 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:59/154 - (38%)
Similarity:86/154 - (55%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QIIVLGAQAVGRAFTKALRQEIAASQ-------EAARR-AGGGKQGDKSAESNLRTGMTLEEAKQ 63
            |:|:.|.|..|:||.:|.||  ||||       .|:|| .|.|:.|          |:||:|:.:
Yeast     8 QVIITGTQVFGKAFAEAYRQ--AASQSVKQGATNASRRGTGKGEYG----------GITLDESCK 60

  Fly    64 ILNIDDPK---NVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQ-------- 117
            ||||::.|   |:|.|...:.:||:||::.||||||:||||:||.|||..|:...|:        
Yeast    61 ILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAKAKAGD 125

  Fly   118 -------PRSSNTEAAQDTAEESQ 134
                   |.|:|:..|.::|..:|
Yeast   126 ASTAKPPPNSTNSSGADNSASSNQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 52/120 (43%)
PAM16NP_012431.1 Pam16 1..128 CDD:252088 53/131 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343684
Domainoid 1 1.000 87 1.000 Domainoid score I1838
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1547
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm46918
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - LDO PTHR12388
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1518
SonicParanoid 1 1.000 - - X3144
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.