DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and AT5G61880

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_568943.1 Gene:AT5G61880 / 836309 AraportID:AT5G61880 Length:113 Species:Arabidopsis thaliana


Alignment Length:126 Identity:46/126 - (36%)
Similarity:74/126 - (58%) Gaps:17/126 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAESNLRTGMTL--EEAKQI 64
            |:.:|.:||:|:..:.||.|:|.||.:|    .|.:.|...:    |...::.|:|:  .||:||
plant     3 ARVLASVIVMGSGIIARACTQAYRQALA----NASKTGVAHE----ATQTIKRGLTIGEAEARQI 59

  Fly    65 LNIDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQPRSSNTEA 125
            |.:.:..:.|.|.|.|:.||:.|  ::.||||:||||.||||.|:   .|::  :|:.|.|
plant    60 LGVTEKSSWDEILKKYDTLFERN--AQNGSFYLQSKVHRAKECLE---TAYQ--KSTTTSA 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 43/116 (37%)
AT5G61880NP_568943.1 DnaJ 1..102 CDD:413365 41/108 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3561
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2501
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - mtm1188
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.