DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and Pam16

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_038942745.1 Gene:Pam16 / 679907 RGDID:1598163 Length:244 Species:Rattus norvegicus


Alignment Length:136 Identity:72/136 - (52%)
Similarity:94/136 - (69%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAESNLRTGMTLEEAKQILN 66
            |||:|||||:|.|.|||||.:|||||.||||.||  ...|:.|.:||.::..:|::|:||:||||
  Rat   121 AKYLAQIIVMGVQVVGRAFARALRQEFAASQAAA--DARGRAGHQSAAASNLSGLSLQEAQQILN 183

  Fly    67 ID--DPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQPRSSNTEAAQDT 129
            |.  .|:.|.   |||||||:||::|.|||||:||||.|||||||.|::..          ||:.
  Rat   184 ISKLSPEEVQ---KNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQ----------AQED 235

  Fly   130 AEESQS 135
            .|:.|:
  Rat   236 REKGQT 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 68/116 (59%)
Pam16XP_038942745.1 Pam16 121..244 CDD:252088 72/136 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340554
Domainoid 1 1.000 128 1.000 Domainoid score I5185
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41100
Inparanoid 1 1.050 128 1.000 Inparanoid score I4569
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - mtm9139
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - LDO PTHR12388
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.