DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and Pam16

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_079847.1 Gene:Pam16 / 66449 MGIID:1913699 Length:125 Species:Mus musculus


Alignment Length:136 Identity:72/136 - (52%)
Similarity:94/136 - (69%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAESNLRTGMTLEEAKQIL 65
            ||||:|||||:|.|.|||||.:|||||.||||.||  ...|:.|.:||.::..:|::|:||:|||
Mouse     1 MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAA--DARGRAGHQSAAASNLSGLSLQEAQQIL 63

  Fly    66 NID--DPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQPRSSNTEAAQD 128
            |:.  .|:.|.   |||||||:||::|.|||||:||||.|||||||.|::..          ||:
Mouse    64 NVSKLSPEEVQ---KNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQ----------AQE 115

  Fly   129 TAEESQ 134
            ..|:.|
Mouse   116 DREKGQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 68/117 (58%)
Pam16NP_079847.1 Pam16 1..125 CDD:252088 72/136 (53%)
J-like 58..110 35/54 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836847
Domainoid 1 1.000 127 1.000 Domainoid score I5365
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41100
Inparanoid 1 1.050 127 1.000 Inparanoid score I4663
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm43960
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - LDO PTHR12388
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1518
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.