DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and pam16

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001004771.1 Gene:pam16 / 447952 XenbaseID:XB-GENE-6454649 Length:125 Species:Xenopus tropicalis


Alignment Length:127 Identity:68/127 - (53%)
Similarity:91/127 - (71%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAESNLRTGMTLEEAKQIL 65
            ||||:|||:|:|.|.||||||:|||||.|||:.||.  ..|:.|.:||..:..:|::|:||:|||
 Frog     1 MAKYLAQIMVMGMQVVGRAFTRALRQEFAASRAAAE--ARGRAGTESAAVSSLSGISLQEAQQIL 63

  Fly    66 NIDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAH---EQPRSSNTE 124
            |: .....:.|.|||||||:||::..|||||:||||.|||||||.|:...   |:|:...|:
 Frog    64 NV-SKLTPEEIQKNYEHLFKVNDKEVGGSFYLQSKVVRAKERLDQEMDIQSKTEKPKDETTQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 65/118 (55%)
pam16NP_001004771.1 DnaJ 1..125 CDD:383015 68/127 (54%)
J-like 58..110 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..125 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5492
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41100
Inparanoid 1 1.050 124 1.000 Inparanoid score I4575
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm49135
Panther 1 1.100 - - LDO PTHR12388
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1518
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.200

Return to query results.
Submit another query.