DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blp and F45G2.8

DIOPT Version :9

Sequence 1:NP_001287349.1 Gene:blp / 41937 FlyBaseID:FBgn0038387 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_499775.1 Gene:F45G2.8 / 176769 WormBaseID:WBGene00009734 Length:136 Species:Caenorhabditis elegans


Alignment Length:129 Identity:55/129 - (42%)
Similarity:86/129 - (66%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QIIVLGAQAVGRAFTKALRQEIAASQEAARR--AGGGKQGD---KSAESNLRTGMTLEEAKQILN 66
            ::.:...:||.:|.|:|:|.||..:|:||.|  |..|:...   ::|.||.:.|::|||:.||||
 Worm     8 KVALAAGEAVAKALTRAVRDEIKQTQQAAARHAASTGQSASETRENANSNAKLGISLEESLQILN 72

  Fly    67 IDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHE---IKAHEQPR---SSNTE 124
            :..|.|.:.:.|:|||||.:|::||||:.|:||||||||||:|.|   |:..|:.:   ::.||
 Worm    73 VKTPLNREEVEKHYEHLFNINDKSKGGTLYLQSKVFRAKERIDEEFGRIELKEEKKKEENAKTE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blpNP_001287349.1 DnaJ 1..117 CDD:295354 52/117 (44%)
F45G2.8NP_499775.1 Pam16 1..135 CDD:252088 53/126 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159118
Domainoid 1 1.000 102 1.000 Domainoid score I4295
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41100
Inparanoid 1 1.050 102 1.000 Inparanoid score I3552
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm14708
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - LDO PTHR12388
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1518
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.