DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment blp and CORO7-PAM16

DIOPT Version :9

Sequence 1:	NP_001287349.1	Gene:	blp / 41937	FlyBaseID:	FBgn0038387	Length:	141	Species:	Drosophila melanogaster
Sequence 2:	NP_001188408.1	Gene:	CORO7-PAM16 / 100529144	HGNCID:	44424	Length:	1048	Species:	Homo sapiens

Alignment Length:	135	Identity:	71/135 - (52%)
Similarity:	93/135 - (68%)	Gaps:	17/135 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 AKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAESNLRTGMTLEEAKQILN 66
            |||:|||||:|.|.|||||.:|||||.|||:.||  ...|:.|.:||.::..:|::|:||:||||
Human   925 AKYLAQIIVMGVQVVGRAFARALRQEFAASRAAA--DARGRAGHRSAAASNLSGLSLQEAQQILN 987

  Fly    67 ID--DPKNVDAITKNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQPRSSNTEAAQDT 129
            :.  .|:.|.   |||||||:||::|.|||||:||||.|||||||.|:|..          ||:.
Human   988 VSKLSPEEVQ---KNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQ----------AQED 1039

  Fly   130 AEESQ 134
            .|:.|
Human  1040 REKGQ 1044

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
blp	NP_001287349.1	DnaJ	1..117	CDD:295354	67/116 (58%)
CORO7-PAM16	NP_001188408.1	DUF1899	5..60	CDD:286094
		WD40	76..295	CDD:295369
		WD40 repeat	81..124	CDD:293791
		WD40 repeat	129..165	CDD:293791
		WD40 repeat	172..208	CDD:293791
		WD40 repeat	215..256	CDD:293791
		WD40 repeat	263..302	CDD:293791
		WD40_4	338..380	CDD:292916
		DUF1899	470..527	CDD:286094
		WD40 repeat	504..540	CDD:293791
		WD40	546..>704	CDD:295369
		WD40 repeat	547..591	CDD:293791
		WD40 repeat	598..634	CDD:293791
		WD40 repeat	640..677	CDD:293791
		WD40_4	808..852	CDD:292916
		Pam16	925..1048	CDD:252088	71/135 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3442
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900