DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and RAD7

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_012586.1 Gene:RAD7 / 853512 SGDID:S000003813 Length:565 Species:Saccharomyces cerevisiae


Alignment Length:415 Identity:96/415 - (23%)
Similarity:163/415 - (39%) Gaps:127/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 WNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNG 453
            |.::.......:|::|.|     :...:.:..|.|:|                |.:| :...|| 
Yeast   183 WQKEADESSKLVFNKLRD-----VLGGVSTANLNNLA----------------KALS-KNRALN- 224

  Fly   454 DKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQAL 518
            |.||::..:           .:::|:..:|..:||..|.:.|....|.||.|.||.|..:.:::|
Yeast   225 DHTLQLFLK-----------TDLKRLTFSDCSKISFDGYKTLAIFSPHLTELSLQMCGQLNHESL 278

  Fly   519 VEALTKCSNLQHLDVTG------------------------------------------C----- 536
            :....|..||:.|::.|                                          |     
Yeast   279 LYIAEKLPNLKSLNLDGPFLINEDTWEKFFVIMKGRLEEFHISNTHRFTDKSLSNLLINCGSTLV 343

  Fly   537 ----SQVSSISPNPHMEPPRRLLLQYL--DLTDCMAI------DDMGLKIVVKNCPQ----LVYL 585
                |::.|||       ...||.|||  |....:.|      :|:..:|::....|    |..|
Yeast   344 SLGLSRLDSIS-------NYALLPQYLVNDEFHSLCIEYPFNEEDVNDEIIINLLGQIGRTLRKL 401

  Fly   586 YLRRCIQVTDA----GL-KFVPSFCVSLKELSVSDCLNITDFGL-YELAKLGAALRYL---SVAK 641
            .|..||.:||:    || .|:|..| .|:.||:.:...||...| |..:|:  .|..|   |..:
Yeast   402 VLNGCIDLTDSMIINGLTAFIPEKC-PLEVLSLEESDQITTDSLSYFFSKV--ELNNLIECSFRR 463

  Fly   642 CERVSDAGLKVI----ARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIG--KCDVSDAG 700
            |.::.|..:..:    ||.  .||.||....:.::.::...||  ||.|..||:|  :| |.|:.
Yeast   464 CLQLGDMAIIELLLNGARD--SLRSLNLNSLKELTKEAFVALA--CPNLTYLDLGFVRC-VDDSV 523

  Fly   701 LRALAESCPNLKKLSLRSCDMITDR 725
            ::.|.|..|||..:.:...:::|::
Yeast   524 IQMLGEQNPNLTVIDVFGDNLVTEK 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 8/45 (18%)
leucine-rich repeat 441..460 CDD:275381 7/18 (39%)
AMN1 <451..595 CDD:187754 44/206 (21%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
leucine-rich repeat 502..521 CDD:275381 7/18 (39%)
leucine-rich repeat 528..555 CDD:275381 8/77 (10%)
leucine-rich repeat 556..581 CDD:275381 7/32 (22%)
AMN1 577..746 CDD:187754 49/168 (29%)
leucine-rich repeat 582..607 CDD:275381 12/29 (41%)
leucine-rich repeat 608..633 CDD:275381 8/25 (32%)
leucine-rich repeat 634..659 CDD:275381 7/31 (23%)
leucine-rich repeat 660..685 CDD:275381 7/24 (29%)
leucine-rich repeat 686..710 CDD:275381 9/25 (36%)
leucine-rich repeat 711..735 CDD:275381 2/15 (13%)
leucine-rich repeat 737..761 CDD:275381
RAD7NP_012586.1 AMN1 228..440 CDD:187754 50/230 (22%)
leucine-rich repeat 236..261 CDD:275381 6/24 (25%)
leucine-rich repeat 262..287 CDD:275381 8/24 (33%)
leucine-rich repeat 288..340 CDD:275381 4/51 (8%)
leucine-rich repeat 342..365 CDD:275381 9/29 (31%)
leucine-rich repeat 368..397 CDD:275381 4/28 (14%)
leucine-rich repeat 398..426 CDD:275381 11/27 (41%)
leucine-rich repeat 428..455 CDD:275381 9/28 (32%)
leucine-rich repeat 456..475 CDD:275381 4/18 (22%)
leucine-rich repeat 484..507 CDD:275381 7/24 (29%)
leucine-rich repeat 508..533 CDD:275381 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2139
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.