DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and AT5G23340

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_197725.1 Gene:AT5G23340 / 832398 AraportID:AT5G23340 Length:405 Species:Arabidopsis thaliana


Alignment Length:329 Identity:103/329 - (31%)
Similarity:153/329 - (46%) Gaps:38/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 EHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLT 496
            :.|.|      |:|    .|:.||. |.:|..:|.:..|  ....:|..||  .|.....|:.|.
plant    13 DELRW------VLS----RLDSDKD-KEVFGLVCKRWLN--LQSTDRKKLA--ARAGPHMLRRLA 62

  Fly   497 RRCPELTHLQLQTCVD------ITNQALVEALTKCSNLQHLDVTGCSQV-----SSISPNPHMEP 550
            .|..::..|.|...:.      :|:..|.........|:.|::..|..:     :||.       
plant    63 SRFTQIVELDLSQSISRSFYPGVTDSDLAVISEGFKFLRVLNLHNCKGITDTGLASIG------- 120

  Fly   551 PRRL-LLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVS 614
             |.| |||:||::.|..:.|.||..|.:.|..|..|:|..|..:||..||.:...|..|:.|.:.
plant   121 -RCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDESLKSLSERCRDLEALGLQ 184

  Fly   615 DCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRC-YKLRYLNARGCEAVSDDSITV 678
            .|.||||.||.:|.|....::.|.:.||..|.|||:..:|:.| ..|:.|....|..|.::||:.
plant   185 GCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESISS 249

  Fly   679 LARSCPRLRALDIGKC-DVSDAGLRALAESC-PNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLN 741
            ||:.|..|..|.||.| |:||..:..||:|| .:||.|.:..|..|:|..:.||...|:.|:.|:
plant   250 LAQFCKNLETLIIGGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCKNLEALD 314

  Fly   742 IQDC 745
            |..|
plant   315 IGCC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 4/14 (29%)
leucine-rich repeat 441..460 CDD:275381 6/18 (33%)
AMN1 <451..595 CDD:187754 40/155 (26%)
leucine-rich repeat 476..501 CDD:275381 7/24 (29%)
leucine-rich repeat 502..521 CDD:275381 4/24 (17%)
leucine-rich repeat 528..555 CDD:275381 7/32 (22%)
leucine-rich repeat 556..581 CDD:275381 10/24 (42%)
AMN1 577..746 CDD:187754 64/172 (37%)
leucine-rich repeat 582..607 CDD:275381 9/24 (38%)
leucine-rich repeat 608..633 CDD:275381 11/24 (46%)
leucine-rich repeat 634..659 CDD:275381 9/25 (36%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 12/25 (48%)
leucine-rich repeat 711..735 CDD:275381 8/23 (35%)
leucine-rich repeat 737..761 CDD:275381 4/9 (44%)
AT5G23340NP_197725.1 F-box_5 12..48 CDD:408301 12/47 (26%)
leucine-rich repeat 68..99 CDD:275381 4/30 (13%)
AMN1 85..323 CDD:187754 83/242 (34%)
leucine-rich repeat 100..125 CDD:275381 7/32 (22%)
leucine-rich repeat 126..151 CDD:275381 10/24 (42%)
leucine-rich repeat 152..177 CDD:275381 9/24 (38%)
leucine-rich repeat 178..203 CDD:275381 11/24 (46%)
leucine-rich repeat 204..230 CDD:275381 9/25 (36%)
leucine-rich repeat 231..256 CDD:275381 9/24 (38%)
leucine-rich repeat 257..283 CDD:275381 12/25 (48%)
leucine-rich repeat 284..309 CDD:275381 9/24 (38%)
leucine-rich repeat 310..336 CDD:275381 4/9 (44%)
leucine-rich repeat 337..362 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1195
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.