DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and VFB3

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_567316.1 Gene:VFB3 / 826171 AraportID:AT4G07400 Length:554 Species:Arabidopsis thaliana


Alignment Length:425 Identity:92/425 - (21%)
Similarity:162/425 - (38%) Gaps:111/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 LPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEH---LNGDKTLKMIFRQLC 465
            ||||.:..||..|...:|...:.||||          |..|..:..|   |.....|..:...|.
plant    77 LPDECLSLIFQSLTCADLKRCSLVCRR----------WLTIEGQCRHRLSLKAQSDLISVIPSLF 131

  Fly   466 GQSCNGACPEVERVMLADGCR---ISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSN 527
            .:     ...|.:::|....|   |.|....:::.||..||.|:|:.|.:|::..::.....|.:
plant   132 TR-----FDSVTKLVLRSDRRSLGICDNAFVMISVRCRNLTRLKLRGCPEISDLGIIGFTENCRS 191

  Fly   528 LQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRR--- 589
            |:.:....|                             .....|:..::..|..|..|.::|   
plant   192 LKKVSFGSC-----------------------------GFGVKGMNALLNTCLGLEELSVKRLRG 227

  Fly   590 --------------------CIQVTDAGLKFVP--SFCVSLKELSVSDC---------------- 616
                                |::....|..|.|  |....|:.|.:..|                
plant   228 IGAGAELIGPGGAAGSLKVICLKELHNGQCFAPLLSGAKGLRILKIFRCSGDWDRVFEAVRDKVN 292

  Fly   617 ---------LNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEA-- 670
                     :.::|.||..|:|. :.:..|.:.|....::.||.::|.||..||.|:..|.:.  
plant   293 AIVEIHLERIQMSDLGLTALSKC-SGVEVLHLVKTPDCTNVGLALVAERCKLLRKLHIDGWKTNR 356

  Fly   671 VSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCR 735
            :.|:.:.|:|:.|..|:.|.:...:.:...|.|:..:|.||::|:|...|.:.|..:.|||..|.
plant   357 IGDEGLIVVAKYCWNLQELVLIGVNPTKLSLEAIVSNCLNLERLALCGSDTVGDTELCCIAEKCL 421

  Fly   736 GLQQLNIQDCPVSIEGYRAVKKYC--------KRC 762
            .|::|.|::||::.:|.:|:...|        |:|
plant   422 ALRKLCIKNCPITDDGIKALGNGCPNLLKVKVKKC 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 14/42 (33%)
leucine-rich repeat 441..460 CDD:275381 5/21 (24%)
AMN1 <451..595 CDD:187754 25/169 (15%)
leucine-rich repeat 476..501 CDD:275381 7/27 (26%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 2/26 (8%)
leucine-rich repeat 556..581 CDD:275381 2/24 (8%)
AMN1 577..746 CDD:187754 50/220 (23%)
leucine-rich repeat 582..607 CDD:275381 8/49 (16%)
leucine-rich repeat 608..633 CDD:275381 8/49 (16%)
leucine-rich repeat 634..659 CDD:275381 7/24 (29%)
leucine-rich repeat 660..685 CDD:275381 8/26 (31%)
leucine-rich repeat 686..710 CDD:275381 5/23 (22%)
leucine-rich repeat 711..735 CDD:275381 8/23 (35%)
leucine-rich repeat 737..761 CDD:275381 8/31 (26%)
VFB3NP_567316.1 F-box-like 74..>104 CDD:289689 12/36 (33%)
leucine-rich repeat 89..114 CDD:275381 8/34 (24%)
leucine-rich repeat 115..165 CDD:275381 10/54 (19%)
AMN1 <146..>226 CDD:187754 19/108 (18%)
leucine-rich repeat 166..191 CDD:275381 7/24 (29%)
leucine-rich repeat 192..216 CDD:275381 4/52 (8%)
leucine-rich repeat 268..293 CDD:275381 3/24 (13%)
leucine-rich repeat 294..317 CDD:275381 5/23 (22%)
leucine-rich repeat 318..343 CDD:275381 7/24 (29%)
AMN1 <340..>463 CDD:187754 35/117 (30%)
leucine-rich repeat 344..371 CDD:275381 8/26 (31%)
leucine-rich repeat 372..396 CDD:275381 5/23 (22%)
leucine-rich repeat 397..422 CDD:275381 9/24 (38%)
leucine-rich repeat 423..447 CDD:275381 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.