DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and AT3G58530

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_567069.1 Gene:AT3G58530 / 825022 AraportID:AT3G58530 Length:353 Species:Arabidopsis thaliana


Alignment Length:350 Identity:86/350 - (24%)
Similarity:145/350 - (41%) Gaps:71/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 RLPDEAVVRIF---SWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMI---- 460
            |||...::.:.   .||              :..|...|.:|..|:||.....||:.|..:    
plant    29 RLPQTDLISLLLVSPWL--------------YRTLISYPSIWLTINLREMTNAGDRLLAALSLPR 79

  Fly   461 FRQ------------------LCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQL 507
            :||                  |....|..|...:|.:.|....:|||.|::.:|..||:|....:
plant    80 YRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAITSICPKLKVFSI 144

  Fly   508 QTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGL 572
            ...|.:|:..:...:..|.::..|:::||.                            ::.|..:
plant   145 YWNVRVTDAGIRNLVKNCRHITDLNLSGCK----------------------------SLTDKSM 181

  Fly   573 KIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYL 637
            ::|.::.|.|..|.:.||:::||.||..|...|.||:.|::......||....:::.| |.||:|
plant   182 QLVAESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLL-ADLRFL 245

  Fly   638 SVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDI-GKCDVSDAGL 701
            .:...:.:||.|:..|| :|.||..||...|..::|..:..:|.||..|..|.: |...|:|..|
plant   246 DICGAQNISDEGIGHIA-KCNKLESLNLTWCVRITDAGVNTIANSCTSLEFLSLFGIVGVTDRCL 309

  Fly   702 RALAESC-PNLKKLSLRSCDMITDR 725
            ..|:::| ..|..|.:..|..|..|
plant   310 ETLSQTCSTTLTTLDVNGCTGIKRR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 9/46 (20%)
leucine-rich repeat 441..460 CDD:275381 7/18 (39%)
AMN1 <451..595 CDD:187754 31/165 (19%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
leucine-rich repeat 502..521 CDD:275381 3/18 (17%)
leucine-rich repeat 528..555 CDD:275381 3/26 (12%)
leucine-rich repeat 556..581 CDD:275381 2/24 (8%)
AMN1 577..746 CDD:187754 48/150 (32%)
leucine-rich repeat 582..607 CDD:275381 10/24 (42%)
leucine-rich repeat 608..633 CDD:275381 5/24 (21%)
leucine-rich repeat 634..659 CDD:275381 9/24 (38%)
leucine-rich repeat 660..685 CDD:275381 8/24 (33%)
leucine-rich repeat 686..710 CDD:275381 8/25 (32%)
leucine-rich repeat 711..735 CDD:275381 4/14 (29%)
leucine-rich repeat 737..761 CDD:275381
AT3G58530NP_567069.1 leucine-rich repeat 30..55 CDD:275381 6/38 (16%)
leucine-rich repeat 56..75 CDD:275381 7/18 (39%)
leucine-rich repeat 83..112 CDD:275381 3/28 (11%)
AMN1 113..342 CDD:187754 66/251 (26%)
leucine-rich repeat 113..138 CDD:275381 8/24 (33%)
leucine-rich repeat 139..164 CDD:275381 4/24 (17%)
leucine-rich repeat 165..190 CDD:275381 5/52 (10%)
leucine-rich repeat 191..216 CDD:275381 10/24 (42%)
leucine-rich repeat 217..266 CDD:275381 15/50 (30%)
leucine-rich repeat 267..292 CDD:275381 8/24 (33%)
leucine-rich repeat 293..318 CDD:275381 8/24 (33%)
leucine-rich repeat 320..339 CDD:275381 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.