DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and AT3G07550

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_566312.1 Gene:AT3G07550 / 819944 AraportID:AT3G07550 Length:395 Species:Arabidopsis thaliana


Alignment Length:364 Identity:95/364 - (26%)
Similarity:153/364 - (42%) Gaps:78/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 DKTLKMIFRQL--------CGQSCNG--ACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQ 508
            |..|..||::|        .|.:|:.  ....:.|..|...|..|......|:           |
plant    20 DDCLSFIFQRLDSVADHDSFGLTCHRWLNIQNISRRSLQFQCSFSVLNPSSLS-----------Q 73

  Fly   509 TCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLK 573
            |..|:::..|...||:...|:||.::||:.::..|.:....|..||...|||.  |..|.|.|:.
plant    74 TNPDVSSHHLHRLLTRFQWLEHLSLSGCTVLNDSSLDSLRYPGARLHTLYLDC--CFGISDDGIS 136

  Fly   574 IVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLS 638
            .:...||.|..:.|.|| .::|.||:.:....:|||.:::|.|..::|||:..|::....|..:.
plant   137 TIASFCPNLSVVSLYRC-NISDIGLETLARASLSLKCVNLSYCPLVSDFGIKALSQACLQLESVK 200

  Fly   639 VAKCERVSDAG----------------------------------LKVIARRCY----------- 658
            ::.|:.::..|                                  |.:....||           
plant   201 ISNCKSITGVGFSGCSPTLGYVDADSCQLEPKGITGIISGGGIEFLNISGVSCYIRKDGLVPIGS 265

  Fly   659 ----KLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKC-DVSDAGLRALAESCPNLKKLSLRS 718
                |||.||.|.|..|.|:||..:|:.||.|:..::..| :|..:|..|:.:.|.|||||.:..
plant   266 GIASKLRILNLRMCRTVGDESIEAIAKGCPLLQEWNLALCHEVKISGWEAVGKWCRNLKKLHVNR 330

  Fly   719 CDMITDRGVQCIAYYCRGLQQL----NIQDCPVSIEGYR 753
            |..:.|:|:..:...|..||.|    |.:..|.:||.:|
plant   331 CRNLCDQGLLALRCGCMNLQILYMNGNARLTPTAIEMFR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689
leucine-rich repeat 441..460 CDD:275381 2/5 (40%)
AMN1 <451..595 CDD:187754 40/150 (27%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
leucine-rich repeat 502..521 CDD:275381 4/18 (22%)
leucine-rich repeat 528..555 CDD:275381 8/26 (31%)
leucine-rich repeat 556..581 CDD:275381 8/24 (33%)
AMN1 577..746 CDD:187754 57/222 (26%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 8/24 (33%)
leucine-rich repeat 634..659 CDD:275381 6/73 (8%)
leucine-rich repeat 660..685 CDD:275381 12/24 (50%)
leucine-rich repeat 686..710 CDD:275381 6/24 (25%)
leucine-rich repeat 711..735 CDD:275381 7/23 (30%)
leucine-rich repeat 737..761 CDD:275381 8/21 (38%)
AT3G07550NP_566312.1 leucine-rich repeat 93..118 CDD:275381 7/24 (29%)
leucine-rich repeat 119..144 CDD:275381 9/26 (35%)
AMN1 142..361 CDD:187754 57/219 (26%)
leucine-rich repeat 145..169 CDD:275381 7/24 (29%)
leucine-rich repeat 170..195 CDD:275381 8/24 (33%)
leucine-rich repeat 196..270 CDD:275381 6/73 (8%)
leucine-rich repeat 271..296 CDD:275381 12/24 (50%)
leucine-rich repeat 297..322 CDD:275381 6/24 (25%)
leucine-rich repeat 323..346 CDD:275381 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.