Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001335097.5 | Gene: | fbxl17 / 795023 | ZFINID: | ZDB-GENE-111013-3 | Length: | 409 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 58/225 - (25%) |
---|---|---|---|
Similarity: | 105/225 - (46%) | Gaps: | 19/225 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 529 QHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYL---RRC 590
Fly 591 IQVTDAGL--KFVPSFCVSL---KELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGL 650
Fly 651 KVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCD-VSDAGLRALAESCPNLKKL 714
Fly 715 SLRSCDMITDRGVQCIAYYCRGLQQLNIQD 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
leucine-rich repeat | 441..460 | CDD:275381 | |||
AMN1 | <451..595 | CDD:187754 | 16/68 (24%) | ||
leucine-rich repeat | 476..501 | CDD:275381 | |||
leucine-rich repeat | 502..521 | CDD:275381 | |||
leucine-rich repeat | 528..555 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 556..581 | CDD:275381 | 5/24 (21%) | ||
AMN1 | 577..746 | CDD:187754 | 47/177 (27%) | ||
leucine-rich repeat | 582..607 | CDD:275381 | 8/29 (28%) | ||
leucine-rich repeat | 608..633 | CDD:275381 | 5/27 (19%) | ||
leucine-rich repeat | 634..659 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 660..685 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 686..710 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 711..735 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 737..761 | CDD:275381 | 3/8 (38%) | ||
fbxl17 | XP_001335097.5 | F-box-like | 221..268 | CDD:289689 | 12/54 (22%) |
AMN1 | 257..>397 | CDD:187754 | 37/139 (27%) | ||
leucine-rich repeat | 262..287 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 288..313 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 314..339 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 340..365 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 366..391 | CDD:275381 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |