DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and FBXL15

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_005270206.1 Gene:FBXL15 / 79176 HGNCID:28155 Length:387 Species:Homo sapiens


Alignment Length:411 Identity:109/411 - (26%)
Similarity:158/411 - (38%) Gaps:110/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 TASGAGIMASST-PTTTPRRGASSN----------GLG-GGAASAIG------------------ 385
            |.|||..:||.| |.|.|......:          ||| |.||...|                  
Human    20 TVSGAVALASFTSPHTHPVDDGGRHYSWGSPKRILGLGPGDAAKEAGLVRPLQGQSEKILLRTRN 84

  Fly   386 -----PPPWNRKGPFRCGPL-FDRLPDEAVV--RIFSWLDSCELCNVARVCRRFEHLAWRPILWK 442
                 ||.....|....|.: |..||.|.|:  .:.:.:...:|..:.||.|.|..|        
Human    85 RQPMEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSL-------- 141

  Fly   443 VISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQL 507
             :.|   ||.|   |:.......|       |::.|..||           .|.|....|..|.|
Human   142 -VQL---HLAG---LRRFDAAQVG-------PQIPRAALA-----------RLLRDAEGLQELAL 181

  Fly   508 QTCVD-ITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMG 571
            ..|.: ::::.||..|.:...|:.:.:.||.|:|           ||                 .
Human   182 APCHEWLSDEDLVPVLARNPQLRSVALGGCGQLS-----------RR-----------------A 218

  Fly   572 LKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELA-KLGAALR 635
            |..:.:.||:|..|.|..|..|....|:.:...|.:|:||.::.|..:.|..:..|| :.||.||
Human   219 LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLR 283

  Fly   636 YLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAG 700
            .||:|....|.||.::.:||.|.:|.:|:..||..|..|.:..||..||.||:|.:..|      
Human   284 SLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHC------ 342

  Fly   701 LRALAESCPNLKKLSLRSCDM 721
             ..:|||  :|.:|..|..|:
Human   343 -HHVAES--SLSRLRKRGVDI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 11/47 (23%)
leucine-rich repeat 441..460 CDD:275381 5/18 (28%)
AMN1 <451..595 CDD:187754 32/144 (22%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
leucine-rich repeat 502..521 CDD:275381 6/19 (32%)
leucine-rich repeat 528..555 CDD:275381 7/26 (27%)
leucine-rich repeat 556..581 CDD:275381 2/24 (8%)
AMN1 577..746 CDD:187754 50/146 (34%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 8/25 (32%)
leucine-rich repeat 634..659 CDD:275381 11/24 (46%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 7/23 (30%)
leucine-rich repeat 711..735 CDD:275381 4/11 (36%)
leucine-rich repeat 737..761 CDD:275381
FBXL15XP_005270206.1 F-box 105..>142 CDD:279040 11/45 (24%)
leucine-rich repeat 149..175 CDD:275381 8/43 (19%)
leucine-rich repeat 176..202 CDD:275381 7/25 (28%)
leucine-rich repeat 203..228 CDD:275381 9/52 (17%)
AMN1 <226..>353 CDD:187754 47/135 (35%)
leucine-rich repeat 229..254 CDD:275381 7/24 (29%)
leucine-rich repeat 255..281 CDD:275381 8/25 (32%)
leucine-rich repeat 282..307 CDD:275381 11/24 (46%)
leucine-rich repeat 308..332 CDD:275381 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.