Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038919.1 | Gene: | amn1 / 751744 | ZFINID: | ZDB-GENE-060825-13 | Length: | 249 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 59/203 - (29%) |
---|---|---|---|
Similarity: | 100/203 - (49%) | Gaps: | 25/203 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 553 RLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVY-----LYLRRCIQVTDAGLKFVPSFCVSLKELS 612
Fly 613 VSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSIT 677
Fly 678 VLARSCPRLRALDIGKCDVSDAGLRALAE---SCPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQ 739
Fly 740 LNIQDCPV 747 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
leucine-rich repeat | 441..460 | CDD:275381 | |||
AMN1 | <451..595 | CDD:187754 | 11/46 (24%) | ||
leucine-rich repeat | 476..501 | CDD:275381 | |||
leucine-rich repeat | 502..521 | CDD:275381 | |||
leucine-rich repeat | 528..555 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 556..581 | CDD:275381 | 4/24 (17%) | ||
AMN1 | 577..746 | CDD:187754 | 53/176 (30%) | ||
leucine-rich repeat | 582..607 | CDD:275381 | 9/29 (31%) | ||
leucine-rich repeat | 608..633 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 634..659 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 660..685 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 686..710 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 711..735 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 737..761 | CDD:275381 | 3/11 (27%) | ||
amn1 | NP_001038919.1 | AMN1 | 33..248 | CDD:187754 | 59/203 (29%) |
leucine-rich repeat | 59..72 | CDD:275381 | 3/13 (23%) | ||
leucine-rich repeat | 82..107 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 108..133 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 134..159 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 160..186 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 187..212 | CDD:275381 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |