DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl15

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:369 Identity:98/369 - (26%)
Similarity:142/369 - (38%) Gaps:96/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PPWNRKGPFRCGP-------LFDRLPDEAVV--RIFSWLDSCELCNVARVCRRFE-----HLAW- 436
            ||..:.|    |.       |.| ||.|.|:  .:.:|:...:|..:.||.|.|.     |||. 
Mouse     3 PPMEQSG----GEQEPGAVRLLD-LPWEDVLLPHVLNWVPLRQLLRLQRVSRAFRALVQLHLARL 62

  Fly   437 --------------RP---ILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADG 484
                          ||   ..|...|.|                |....|....|...||    |
Mouse    63 RRFDAAQVSRGPEPRPRHAPAWVPPSPR----------------LQASPCCAVNPSRPRV----G 107

  Fly   485 CRISDKGLQLLTRRCPELTHLQLQTCVD-ITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHM 548
            .:|....|..|.|....|..|.|..|.: ::::.||..|.:...|:.:.:.||.|:|        
Mouse   108 PQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALAGCGQLS-------- 164

  Fly   549 EPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSV 613
               ||                 .|..:.:.||:|..|.|..|..|....|:.:...|.:|:||.:
Mouse   165 ---RR-----------------ALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDL 209

  Fly   614 SDCLNITDFGLYELA-KLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSIT 677
            :.|..:.|..:..|| :.||.||.||:|....|.|..::.:||.|.:|.:|:..||..|..|.:.
Mouse   210 TACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVR 274

  Fly   678 VLARSCPRLRALDIGKCDVSDAGLRALAESCPNLKKLSLRSCDM 721
            .||..||.||:|.:..|       ..:||  |:|.:|..|..|:
Mouse   275 TLAEYCPALRSLRVRHC-------HHVAE--PSLSRLRKRGVDI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 18/70 (26%)
leucine-rich repeat 441..460 CDD:275381 3/18 (17%)
AMN1 <451..595 CDD:187754 32/144 (22%)
leucine-rich repeat 476..501 CDD:275381 7/24 (29%)
leucine-rich repeat 502..521 CDD:275381 6/19 (32%)
leucine-rich repeat 528..555 CDD:275381 7/26 (27%)
leucine-rich repeat 556..581 CDD:275381 2/24 (8%)
AMN1 577..746 CDD:187754 49/146 (34%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 8/25 (32%)
leucine-rich repeat 634..659 CDD:275381 10/24 (42%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 6/23 (26%)
leucine-rich repeat 711..735 CDD:275381 4/11 (36%)
leucine-rich repeat 737..761 CDD:275381
Fbxl15NP_001365702.1 F-box 18..55 CDD:395521 12/37 (32%)
leucine-rich repeat 125..151 CDD:275381 7/25 (28%)
leucine-rich repeat 152..177 CDD:275381 9/52 (17%)
AMN1 <175..>304 CDD:187754 47/137 (34%)
leucine-rich repeat 178..203 CDD:275381 7/24 (29%)
leucine-rich repeat 204..230 CDD:275381 8/25 (32%)
leucine-rich repeat 231..256 CDD:275381 10/24 (42%)
leucine-rich repeat 257..281 CDD:275381 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.