DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and FBXL17

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:778 Identity:166/778 - (21%)
Similarity:263/778 - (33%) Gaps:253/778 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PLSSSPLDPQAY------KMMSRKSPNPGLEVAEALASR---SSTPPSDQAGASSTAAAAAVLHM 91
            |||..|.| .||      :.::|:......|...|.|.|   ||...:..|.||:::.|:....:
Human    81 PLSPPPRD-GAYAAASSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAAASASSPASCCKEL 144

  Fly    92 VQQKAATFELRGR-----HSRPTEQQTSYGAHSTASVGRHAKKSP-ELPAP----ASRNVAPVP- 145
            ....||.:|.:||     ...|..   ..|..:...:.|....|| |||.|    ..|..|.|| 
Human   145 GLAAAAAWEQQGRSLFLASLGPVR---FLGPPAAVQLFRGPTPSPAELPTPPEMVCKRKGAGVPA 206

  Fly   146 -----QPRNFLTLEHVLQFGTQRPSWMHGNSADTEDSSDNNAGGGGAGSGSGGAGGRRRAQGGRC 205
                 |||                                 .||||.|.|.||.||         
Human   207 CTPCKQPR---------------------------------CGGGGCGGGGGGGGG--------- 229

  Fly   206 SVPTVLSSNGSGGNGAQYLLDKKMESLYLGNALRTLPLGAEASQFQNERYYLEDYSSGSGNERLP 270
                    .|..|.||                  :.|...:|                 |..:.|
Human   230 --------GGPAGGGA------------------SPPRPPDA-----------------GCCQAP 251

  Fly   271 ERLHHPRTSSPSETSGSDRYLLNRSSNSNHLHSKGQSLSDGLCNLGRFSPSLDQGYATLVSPSPT 335
            |:...|                                   ||                  |.| 
Human   252 EQPPQP-----------------------------------LC------------------PPP- 262

  Fly   336 GHHSSGGAGNVTNSTTASGAGIMASSTPTTTPRRGASSNGLGGGAASAIGPPPWNRKGPFRCG-- 398
                        :|.|:.||       ||..          ||.|..|.|..|.:.:....||  
Human   263 ------------SSPTSEGA-------PTEA----------GGDAVRAGGTAPLSAQQQHECGDA 298

  Fly   399 --------------------PLFDRLPDEAVVRIFSWLDSCELC-NVARVCRRFEHLAWRPILWK 442
                                |..::||...:::|||.|...|.| :.:.||:.:..|......||
Human   299 DCRESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQFWK 363

  Fly   443 VISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCR-ISDKGLQLLTRRCPELTHLQ 506
            .:.|.......|:.|:    ::..:|.|     :..:.::| || :||.|:.:|..:||.|....
Human   364 QLDLSSRQQVTDELLE----KIASRSQN-----IIEINISD-CRSMSDNGVCVLAFKCPGLLRYT 418

  Fly   507 LQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTD-----CMA 566
            ...|..:::.:::...:.|..||.:.|....:::.       |..::|..:..:|.|     |..
Human   419 AYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTD-------EGLKQLGSKCRELKDIHFGQCYK 476

  Fly   567 IDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKL- 630
            |.|.|:.::.|.|.:|..:|::....|||..:|.....|..|:.:....| ::|..|:..|.|| 
Human   477 ISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGC-SVTSKGVIHLTKLR 540

  Fly   631 ---GAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIG 692
               ...||:::....|.|.:     |.:||..|..||......::|..:.|:|:....|:.|.:.
Human   541 NLSSLDLRHITELDNETVME-----IVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLV 600

  Fly   693 KCDVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDCPVSIEGYRAV 755
            .|.::|..|.|:......::.:.:..|..|||:|...||...:.|:.|.:..|......|:.|
Human   601 SCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVRVDYQVV 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 13/46 (28%)
leucine-rich repeat 441..460 CDD:275381 5/18 (28%)
AMN1 <451..595 CDD:187754 32/149 (21%)
leucine-rich repeat 476..501 CDD:275381 8/25 (32%)
leucine-rich repeat 502..521 CDD:275381 2/18 (11%)
leucine-rich repeat 528..555 CDD:275381 4/26 (15%)
leucine-rich repeat 556..581 CDD:275381 8/29 (28%)
AMN1 577..746 CDD:187754 44/172 (26%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 7/28 (25%)
leucine-rich repeat 634..659 CDD:275381 7/24 (29%)
leucine-rich repeat 660..685 CDD:275381 6/24 (25%)
leucine-rich repeat 686..710 CDD:275381 6/23 (26%)
leucine-rich repeat 711..735 CDD:275381 7/23 (30%)
leucine-rich repeat 737..761 CDD:275381 5/19 (26%)
FBXL17XP_005272105.1 F-box-like 321..368 CDD:289689 13/46 (28%)
leucine-rich repeat 362..387 CDD:275381 6/28 (21%)
leucine-rich repeat 388..413 CDD:275381 8/25 (32%)
AMN1 411..573 CDD:187754 41/174 (24%)
leucine-rich repeat 414..439 CDD:275381 3/24 (13%)
leucine-rich repeat 440..465 CDD:275381 5/31 (16%)
leucine-rich repeat 466..491 CDD:275381 8/24 (33%)
leucine-rich repeat 492..517 CDD:275381 7/24 (29%)
leucine-rich repeat 518..541 CDD:275381 7/23 (30%)
leucine-rich repeat 542..567 CDD:275381 7/29 (24%)
AMN1 547..>652 CDD:187754 28/109 (26%)
leucine-rich repeat 568..593 CDD:275381 6/24 (25%)
leucine-rich repeat 594..615 CDD:275381 6/20 (30%)
leucine-rich repeat 619..641 CDD:275381 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.