| Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001011123.1 | Gene: | fbxl15 / 496536 | XenbaseID: | XB-GENE-973058 | Length: | 292 | Species: | Xenopus tropicalis |
| Alignment Length: | 229 | Identity: | 66/229 - (28%) |
|---|---|---|---|
| Similarity: | 107/229 - (46%) | Gaps: | 32/229 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 485 CRISDK---GLQL-------LTRRCPELTHLQLQTCVD-ITNQALVEALTKCSNLQHLDVTGCSQ 538
Fly 539 VS-----SISPN-PHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAG 597
Fly 598 LKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRY 662
Fly 663 LNARGCEAVSDDSI-------TVLARSCPRLRAL 689 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
| leucine-rich repeat | 441..460 | CDD:275381 | |||
| AMN1 | <451..595 | CDD:187754 | 36/126 (29%) | ||
| leucine-rich repeat | 476..501 | CDD:275381 | 8/25 (32%) | ||
| leucine-rich repeat | 502..521 | CDD:275381 | 8/19 (42%) | ||
| leucine-rich repeat | 528..555 | CDD:275381 | 8/32 (25%) | ||
| leucine-rich repeat | 556..581 | CDD:275381 | 8/24 (33%) | ||
| AMN1 | 577..746 | CDD:187754 | 35/120 (29%) | ||
| leucine-rich repeat | 582..607 | CDD:275381 | 5/24 (21%) | ||
| leucine-rich repeat | 608..633 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 634..659 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 660..685 | CDD:275381 | 7/31 (23%) | ||
| leucine-rich repeat | 686..710 | CDD:275381 | 3/4 (75%) | ||
| leucine-rich repeat | 711..735 | CDD:275381 | |||
| leucine-rich repeat | 737..761 | CDD:275381 | |||
| fbxl15 | NP_001011123.1 | leucine-rich repeat | 47..81 | CDD:275381 | 8/25 (32%) |
| AMN1 | 65..251 | CDD:187754 | 54/193 (28%) | ||
| leucine-rich repeat | 82..108 | CDD:275381 | 8/25 (32%) | ||
| leucine-rich repeat | 109..134 | CDD:275381 | 6/24 (25%) | ||
| LRR 1 | 134..155 | 7/28 (25%) | |||
| leucine-rich repeat | 135..160 | CDD:275381 | 8/24 (33%) | ||
| LRR 2 | 160..181 | 5/20 (25%) | |||
| leucine-rich repeat | 161..186 | CDD:275381 | 5/24 (21%) | ||
| LRR 3 | 186..207 | 8/20 (40%) | |||
| leucine-rich repeat | 187..212 | CDD:275381 | 10/24 (42%) | ||
| LRR 4 | 212..233 | 5/20 (25%) | |||
| leucine-rich repeat | 213..238 | CDD:275381 | 7/24 (29%) | ||
| LRR 5 | 238..259 | 6/20 (30%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||