DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and FipoQ

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:493 Identity:108/493 - (21%)
Similarity:178/493 - (36%) Gaps:156/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 KGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLR----GEHLN 452
            :.|| .....::|||:.::.|||:|...|:|.:||:|||:..:|:...|||.:|||    |.|:.
  Fly    26 RSPF-ADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVG 89

  Fly   453 GDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTR--------RCPELTHLQLQ- 508
               :|:|:.:.:             .|......|..:..::|:|.        :||.|||:.|. 
  Fly    90 ---SLEMLLQLI-------------SVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDF 138

  Fly   509 ---------------------TCVDITNQALVEAL--------------------TKCSNLQH-- 530
                                 .||.::....:|..                    .||...:.  
  Fly   139 STAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEI 203

  Fly   531 LDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTD 595
            .:|....::.|.:||          |:.::|.....|||..:.....||.||..|.:..|.:||.
  Fly   204 YEVINVHKLKSATPN----------LRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTG 258

  Fly   596 AGLK----------------------FV--------------------PSFCV--------SLKE 610
            :.||                      ||                    .:.|:        |||.
  Fly   259 STLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKF 323

  Fly   611 LSVSDCLNITDFGLYELAKLGA--ALRYLSVAKCERVSDAG-LKVIARRCYKLRYLNARGCEAVS 672
            ||........|..|.:..:.|.  :|..|.:...:.:||.| ||.|.|:.::|......|...::
  Fly   324 LSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHIT 388

  Fly   673 DD---SITVLARSCPRLRALDIGKCDVS---DAGLRALAESCPNLKKLSLR-SCDMI-----TDR 725
            |.   ||..|..:|..:......|..|:   |..:..:|.:|.||::|.|| ..|.:     :.:
  Fly   389 DQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDKSQK 453

  Fly   726 GVQCIAYYCRGLQQLNIQDCPVSIEG--YRAVKKYCKR 761
            .:..:...|..|:      |.|..:|  |..||...:|
  Fly   454 AIDILRVKCLKLR------CMVLSDGRYYETVKANFER 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 19/45 (42%)
leucine-rich repeat 441..460 CDD:275381 8/22 (36%)
AMN1 <451..595 CDD:187754 33/195 (17%)
leucine-rich repeat 476..501 CDD:275381 5/32 (16%)
leucine-rich repeat 502..521 CDD:275381 6/40 (15%)
leucine-rich repeat 528..555 CDD:275381 4/28 (14%)
leucine-rich repeat 556..581 CDD:275381 7/24 (29%)
AMN1 577..746 CDD:187754 50/233 (21%)
leucine-rich repeat 582..607 CDD:275381 10/74 (14%)
leucine-rich repeat 608..633 CDD:275381 7/26 (27%)
leucine-rich repeat 634..659 CDD:275381 9/25 (36%)
leucine-rich repeat 660..685 CDD:275381 7/27 (26%)
leucine-rich repeat 686..710 CDD:275381 5/26 (19%)
leucine-rich repeat 711..735 CDD:275381 5/29 (17%)
leucine-rich repeat 737..761 CDD:275381 7/25 (28%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 19/45 (42%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 7/24 (29%)
leucine-rich repeat 271..295 CDD:275381 2/23 (9%)
leucine-rich repeat 296..320 CDD:275381 1/23 (4%)
leucine-rich repeat 321..348 CDD:275381 7/26 (27%)
leucine-rich repeat 349..375 CDD:275381 9/25 (36%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457923
Domainoid 1 1.000 59 1.000 Domainoid score I10693
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.