DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and CG5003

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster


Alignment Length:640 Identity:143/640 - (22%)
Similarity:207/640 - (32%) Gaps:216/640 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RNSNAVRDH--YHHPHPLSSSPLDPQAYKMMSRKSPNPGLEVAEALASRSST---------PPSD 75
            |..|.:.||  ||| ..||:.||.               :.:.|.:..|::.         |||.
  Fly    98 RFENLLLDHRFYHH-IDLSNGPLP---------------MGILEEILGRATEKTHTIKICGPPSS 146

  Fly    76 QAGASS----TAAAAAVL-HMVQQKAATFELRGRHSRPTEQQTSYGAHSTASVGRHAKKSPELPA 135
            |..|..    |...::|. .:||.|  ..||.|     ......| .|.|           |.||
  Fly   147 QHVAGEFRQFTQTLSSVFPRVVQLK--VLELEG-----VSLDFEY-IHIT-----------EFPA 192

  Fly   136 PASR------NVAPVPQPRN-FLTLE-HVLQFGTQRPSWMHGNSADTEDSS--DNNAGGGGAGSG 190
            ...|      :|.....|:: |.::| |:|               |.||.|  ||:........|
  Fly   193 TLRRLKLKDCSVRVGDTPKSIFYSIELHLL---------------DLEDLSIEDNSWFEPYYIMG 242

  Fly   191 SGGAGGRRRAQGGRCS-----VPTVLSSNGSGGNGAQYLLDKKMESLYLGNALRTLPLGAEASQF 250
            .......||.....|.     ||       .|...|::.. :|:|||    .||..|:..     
  Fly   243 LSKLPSLRRLSLKGCQALCKFVP-------YGSMAARFGF-QKLESL----DLRQTPINN----- 290

  Fly   251 QNERYYLEDYSSGSGNERLPERLHHPRTSSPSETSGSDRYLLNRSSNSNHLHSKGQSLSDGLCNL 315
                   .|....|..|.|.|.|    ..|| :...|.:.:..:::|.|..........|.|..|
  Fly   291 -------SDLQCFSAIENLKELL----LESP-QILHSKQAVAKKNTNGNATDEAASPQPDSLKVL 343

  Fly   316 GRFSPSLDQGYATLV-------------------SPSPTGHHSSG---------GAGNVTNSTTA 352
            ....||..:.....:                   ||.||...|.|         ......:..|:
  Fly   344 SDDEPSTSRAAMEHLRACKVAFNLDNCSDRKEEKSPVPTEPPSEGQDLQAKRIRAPSESDDEDTS 408

  Fly   353 SGAGIMASSTPT-TTPRRGASSNG-LGGG-----------AASAIGPP----PWNRKGPFRCGPL 400
            |.:|..:..... :.||.|.|:.. |.||           ||:|...|    ..|.:.|.:...|
  Fly   409 STSGSSSDKLEVLSLPRNGHSNAAPLSGGVDLPPLPHAADAANAADAPIAVDAANIEAPGQSPGL 473

  Fly   401 FDR-------LPD---------EAVVRIFSWLDSCEL------------CNVARVCRR------- 430
            ..|       :||         .:||.:|:  ...|.            .||....||       
  Fly   474 DPRPPRAYIYVPDAENANPRQQRSVVAVFA--QGTEQRYIYVNQQFSLPMNVLMPTRRHRTHPRP 536

  Fly   431 -FEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPE---VERVMLADGCRISDKG 491
             ::.:...|:.|.::    |.|:.|...::..|.   .||. ..|:   .:|.|.:.|  .:|:.
  Fly   537 NYDQVVQHPMFWNML----EPLDRDYARRVRPRP---PSCQ-TTPQYYVTDRAMYSFG--RADRP 591

  Fly   492 LQ------LLTRRCPE--LTHLQLQTCVDITNQALVEALTKCS-NLQHLDVTGCS 537
            :|      ....|.|:  |..|.|:....|||..| |.|.:|| ||.::||:|.|
  Fly   592 VQPDVVWIRNINRSPDNKLERLSLRNYHLITNHTL-EHLVQCSPNLVYIDVSGTS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 13/81 (16%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 30/99 (30%)
leucine-rich repeat 476..501 CDD:275381 6/30 (20%)
leucine-rich repeat 502..521 CDD:275381 7/18 (39%)
leucine-rich repeat 528..555 CDD:275381 5/10 (50%)
leucine-rich repeat 556..581 CDD:275381
AMN1 577..746 CDD:187754
leucine-rich repeat 582..607 CDD:275381
leucine-rich repeat 608..633 CDD:275381
leucine-rich repeat 634..659 CDD:275381
leucine-rich repeat 660..685 CDD:275381
leucine-rich repeat 686..710 CDD:275381
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
CG5003NP_651593.1 F-box 68..114 CDD:279040 7/16 (44%)
leucine-rich repeat 610..635 CDD:275381 11/25 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.