DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and FBXO11

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster


Alignment Length:492 Identity:105/492 - (21%)
Similarity:158/492 - (32%) Gaps:172/492 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSPLDPQAYKMMSRKS-------PN-PGLEVAEALASRSSTPPSDQAGASSTAAAAAVLHMVQQ 94
            |:|....:.|...||:.       || |...:.:.:..::.|    .|||.::|:.:.     ..
  Fly     3 SASFTSSRTYVRRSRRKGANRIAMPNRPTGNIMDPMLQQNVT----AAGAGASASGSN-----SN 58

  Fly    95 KAATFELRGRHSRPTEQQTSYGAHSTA-SVGRHAKKSPELPAPASRNVAPVPQPRNFLTLEHVLQ 158
            .|::....|..:.......|.||.||: |....|..:....|.||                    
  Fly    59 AASSSGAGGVGNNNASSSGSSGATSTSGSAAAAASAAGPTAAGAS-------------------- 103

  Fly   159 FGTQRPSWMHGNSADTEDSSDNNAGGGGAGSGSGGAGGRRRAQGGRCSVPTVLSSNGSGGN---- 219
                       :||:..||....:|..||.| ||.:|....|    ..:.....|:|:|.:    
  Fly   104 -----------SSAEYFDSGQGASGSSGAAS-SGFSGSFYNA----LQMMDTTESSGAGTSQSTP 152

  Fly   220 ---GAQYLLDKKMESLYLG------NALRTLPLGAEASQFQNERYYLEDYSSGSGNERLPERLHH 275
               ||......|.....:|      :|.......|.|.......|.|....|.|.:|:.|     
  Fly   153 PALGASSTTASKSTCATVGSSTASTSAAAAAAASASAGSSHQSPYDLRRKISASSHEQWP----- 212

  Fly   276 PRTSSPSETSGSDRYLLNRSSNSNHLHSKGQSLSDGLCNLGRFSPSLDQGYATLVSPSPTGHHSS 340
              |||.|..:.:...|:..||:|..|.:.|                        .|||.:...||
  Fly   213 --TSSSSAVAAAAAILVGPSSSSPPLVNPG------------------------ASPSSSSSSSS 251

  Fly   341 GGAGNVTNSTTASGAGIMASST---------PTT------------------------------- 365
            ..:.:.:.|:::|.:.:.|.||         |||                               
  Fly   252 SSSSSSSASSSSSSSNVQAPSTSATFPVNNAPTTGATLAQPPNVHSSVPQQHCGALPVGAAIEDN 316

  Fly   366 --------------------TPRRGASSNGLGGGAASAIGPPPWNRKGPFRCGP-----LFDRLP 405
                                .|..||:....|.|.|::         |...|.|     |...||
  Fly   317 NYMLPARKRSRRLYTQGGEMGPSAGATGEAAGAGTAAS---------GGAGCAPTAAQYLQYELP 372

  Fly   406 DEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWK 442
            ||.::.|||:|...:||.:|.||:||..:|....|||
  Fly   373 DEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 19/42 (45%)
leucine-rich repeat 441..460 CDD:275381 2/2 (100%)
AMN1 <451..595 CDD:187754
leucine-rich repeat 476..501 CDD:275381
leucine-rich repeat 502..521 CDD:275381
leucine-rich repeat 528..555 CDD:275381
leucine-rich repeat 556..581 CDD:275381
AMN1 577..746 CDD:187754
leucine-rich repeat 582..607 CDD:275381
leucine-rich repeat 608..633 CDD:275381
leucine-rich repeat 634..659 CDD:275381
leucine-rich repeat 660..685 CDD:275381
leucine-rich repeat 686..710 CDD:275381
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 19/40 (48%)
Beta_helix 650..796 CDD:289971
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.