DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and fbxl15

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_998107.1 Gene:fbxl15 / 405878 ZFINID:ZDB-GENE-040426-2440 Length:296 Species:Danio rerio


Alignment Length:323 Identity:94/323 - (29%)
Similarity:143/323 - (44%) Gaps:65/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 DRLPDEAVVRIFSWLDSCELCNV----ARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMIFR 462
            |:.|||   |:.|  ..|||.::    ..|...|.||..|    .::||        :.:...||
Zfish     2 DQKPDE---RMQS--HRCELLDLPWEDVLVSHVFCHLPLR----LLVSL--------QRVSKSFR 49

  Fly   463 QLCGQSCNGACPEVERVMLADGCRISD----------KGLQLLTRRCPELTHLQLQTCVD-ITNQ 516
            .|.            :|.| |.||..|          :....:.|....|.||.:..|.| ||:.
Zfish    50 SLI------------QVYL-DNCRTFDPAQTGPHIPREAFCSILRHNQVLQHLSVTNCSDWITDT 101

  Fly   517 ALVEALTKCSNLQHLDVTGCSQVS-----SISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVV 576
            .|:..:.:...|||:|:.||:|:|     ::|    :..||   ||:|.|..|..:|.:.|:.:.
Zfish   102 DLLPVIGQNQQLQHVDLRGCAQLSRRALVAVS----LSCPR---LQHLSLAHCEWVDSLALRSLA 159

  Fly   577 KNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAK 641
            .:||.|..|.|..|.|:.|..:.::...|..|:.|||:...||||..:.|:||....:..|.:..
Zfish   160 DHCPMLRSLDLTACRQLKDPAVCYLAGKCPELRALSVAVNANITDTAVEEVAKKCREMERLDLTG 224

  Fly   642 CERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRAL 704
            |.||.:..::.:|..|.||:.|....|..|::.|:.||.|     |.::|   ||.....|||
Zfish   225 CLRVRNEAIRTLAEYCPKLQSLKVNHCHNVTESSLGVLRR-----RNVEI---DVEPPLQRAL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 15/48 (31%)
leucine-rich repeat 441..460 CDD:275381 2/18 (11%)
AMN1 <451..595 CDD:187754 43/159 (27%)
leucine-rich repeat 476..501 CDD:275381 7/34 (21%)
leucine-rich repeat 502..521 CDD:275381 8/19 (42%)
leucine-rich repeat 528..555 CDD:275381 11/31 (35%)
leucine-rich repeat 556..581 CDD:275381 8/24 (33%)
AMN1 577..746 CDD:187754 42/128 (33%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 11/24 (46%)
leucine-rich repeat 634..659 CDD:275381 6/24 (25%)
leucine-rich repeat 660..685 CDD:275381 8/24 (33%)
leucine-rich repeat 686..710 CDD:275381 7/19 (37%)
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
fbxl15NP_998107.1 F-box 16..>52 CDD:279040 10/47 (21%)
leucine-rich repeat 51..85 CDD:275381 8/46 (17%)
leucine-rich repeat 86..112 CDD:275381 8/25 (32%)
AMN1 <111..272 CDD:187754 56/175 (32%)
leucine-rich repeat 113..138 CDD:275381 9/28 (32%)
LRR 1 138..159 8/23 (35%)
leucine-rich repeat 139..164 CDD:275381 8/24 (33%)
LRR 2 164..185 6/20 (30%)
leucine-rich repeat 165..190 CDD:275381 7/24 (29%)
LRR 3 190..211 9/20 (45%)
leucine-rich repeat 191..216 CDD:275381 11/24 (46%)
LRR 4 216..237 4/20 (20%)
leucine-rich repeat 217..242 CDD:275381 6/24 (25%)
LRR 5 242..263 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.