DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Skp2

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster


Alignment Length:731 Identity:158/731 - (21%)
Similarity:249/731 - (34%) Gaps:257/731 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NRRSSDLE--CPLASLGRNSNAVRDHY-------------HHPHPLSSSPLDPQAYKMMSRKSPN 56
            :|.|.::|  ||:.   |..:..::|.             |:.||.|.|.|..:|.:.|      
  Fly     6 HRGSENMENLCPVT---RKRSTNKNHVSVVGALVSTTKSSHYEHPSSPSALTFEALEEM------ 61

  Fly    57 PGLEVAEALASRSSTPPSDQAGASSTAAAAAVLHMVQQKAATFELRGRHSRPTEQQTSYGAHSTA 121
             |:.:.:          |:::.:|:.:|.|..:      :||.:.....:.|           .|
  Fly    62 -GIGMLD----------SEESSSSALSAIALAV------SATSDDNSNETTP-----------CA 98

  Fly   122 SVGRHAKKSPELPAPASRNVAPVPQPRNFLTLEHVLQFGTQRPSWMHGNSAD-TEDSSDNNAGGG 185
            ||.|.|                           |.||. |||.|.  |::.| |.||.       
  Fly    99 SVSRMA---------------------------HQLQH-TQRLSL--GSTGDITLDSP------- 126

  Fly   186 GAGSGSGGAGGRRRAQGGRCSVPTVLSSNGSGGNGAQYLLDKKMESLYLGNALRTLPLGAEASQF 250
                                :|...||.:.......|.|...|..|           ||:|    
  Fly   127 --------------------AVEDSLSMSRQSAEKLQILAQAKRSS-----------LGSE---- 156

  Fly   251 QNERYYLEDYSSGSGNERLP-ERLHHPRTSSPSETSGSDRYLLNRSSNSNHLHSKGQSLSDGLCN 314
                        ||||...| :||.:|               |...:.:|.:        ||..:
  Fly   157 ------------GSGNSNSPSKRLRNP---------------LAAVTCNNQI--------DGTAS 186

  Fly   315 LGRFSPSLDQGYATLVSPSPTGHHSSGGAGNVTNSTTASGAGIMASST--PTTTPRRGASSNGLG 377
            | .|.||..:......:..|          :.||.||.    |:|:.:  ...||...|..|   
  Fly   187 L-NFQPSTSRLAQVRQAKKP----------STTNITTR----IVAADSFFVFRTPAMSAHIN--- 233

  Fly   378 GGAASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWK 442
                |.|.              .|:||.||.::.||.||....|..:|.|||||...:....||.
  Fly   234 ----SGIN--------------YFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWT 280

  Fly   443 VISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVER-----VMLADG------------------ 484
            .:.|      |.:|::           .||..::.|     :.||..                  
  Fly   281 RLDL------GLRTIR-----------PGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRL 328

  Fly   485 -------CRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSI 542
                   ..|:...|..|...|.:|..:.|:. :::.:....| :.|...|:.:::|..|.::|.
  Fly   329 QYLDLSMASITRSSLLTLLSHCRQLKKISLEN-IELDDDICAE-IAKNEALEAVNLTMASGLTSN 391

  Fly   543 SPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVT-DAGLKFVPSFCV 606
            |....||....|....:..||..|  |....:|....|.|:.|.:..|.:|. |:.:..:...|.
  Fly   392 SVRLMMESLTSLSSLNISWTDLSA--DAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRCP 454

  Fly   607 SLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCY-KLRYLNARGCEA 670
            .|.||.:|||.::|...:..:.|. ..|.||||::|..:  ...|.|..:.. .|.||:..|  .
  Fly   455 QLLELDLSDCNSLTPTVITAIMKF-KMLEYLSVSRCYLI--PATKFIELKSMPSLTYLDIFG--M 514

  Fly   671 VSDDSITVLARSCPRL 686
            :||.::.||.:..|::
  Fly   515 LSDTAMEVLEKQLPKM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 18/45 (40%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 33/174 (19%)
leucine-rich repeat 476..501 CDD:275381 7/54 (13%)
leucine-rich repeat 502..521 CDD:275381 2/18 (11%)
leucine-rich repeat 528..555 CDD:275381 7/26 (27%)
leucine-rich repeat 556..581 CDD:275381 5/24 (21%)
AMN1 577..746 CDD:187754 32/112 (29%)
leucine-rich repeat 582..607 CDD:275381 6/25 (24%)
leucine-rich repeat 608..633 CDD:275381 8/24 (33%)
leucine-rich repeat 634..659 CDD:275381 8/25 (32%)
leucine-rich repeat 660..685 CDD:275381 8/24 (33%)
leucine-rich repeat 686..710 CDD:275381 0/1 (0%)
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 18/44 (41%)
leucine-rich repeat 302..327 CDD:275381 2/24 (8%)
AMN1 309..480 CDD:187754 36/175 (21%)
leucine-rich repeat 328..352 CDD:275381 4/23 (17%)
leucine-rich repeat 353..376 CDD:275381 4/24 (17%)
leucine-rich repeat 377..402 CDD:275381 7/24 (29%)
leucine-rich repeat 403..428 CDD:275381 6/26 (23%)
leucine-rich repeat 429..455 CDD:275381 6/25 (24%)
leucine-rich repeat 456..480 CDD:275381 8/24 (33%)
leucine-rich repeat 481..500 CDD:275381 8/20 (40%)
leucine-rich repeat 506..529 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.