DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Y55F3C.9

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001343666.1 Gene:Y55F3C.9 / 3896809 WormBaseID:WBGene00044459 Length:732 Species:Caenorhabditis elegans


Alignment Length:401 Identity:80/401 - (19%)
Similarity:156/401 - (38%) Gaps:97/401 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHL 451
            |.|.|:...:.|.||..  :....|....:||  |.|:|.     |.:|      |.::      
 Worm   202 PYWIREQERKEGLLFHF--ESYYNRSHHMIDS--LSNIAA-----ERIA------KYMN------ 245

  Fly   452 NGDKTLKMIFRQLCGQSCNGACPEVERV------MLADGCRISDKGLQLLTRRCPELTH---LQL 507
            |||..:.....::..|||......:.::      ::|:.|:.......:|.::...|.:   :.:
 Worm   246 NGDYIISKAVERMDAQSCEVVFSNLLKLNPSQSGVIAEVCKNRSLHSLILGKKKKILKYGKKIDV 310

  Fly   508 QTCVD-ITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCM----AI 567
            ...:| |.|:      ...:.|:.||::...|:.      ....|.::......||..:    .:
 Worm   311 VCLIDCIVNE------NSRTTLKSLDISKSEQIL------RQGWPEKIADMLPSLTTFILSGKKL 363

  Fly   568 DDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNI---TDFGLYELAK 629
            .:..:.:::|:.|.|      .|:.::|..:|.:.... :|..|.|....|:   |.|.:.:|..
 Worm   364 TENEMTLLIKSFPNL------SCLDISDTNIKNLNGIS-NLTHLQVLSMRNLHFNTWFDMMDLFN 421

  Fly   630 LGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKC 694
            | ..|.:|.|:...  .:.|:|.:.:..         ||           .:|..:|..||....
 Worm   422 L-KNLTFLDVSHDH--YNTGIKTMQQFI---------GC-----------GKSIEKLAFLDCTST 463

  Fly   695 DVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCR--GLQQLNIQDCPVSIEG---YRA 754
            |::|..|.:|.||.|||:|::          .:.|:..|.:  .||.||::....|::.   :.:
 Worm   464 DLNDNLLNSLMESHPNLQKIT----------ALNCLVQYSKIPELQVLNMESIGSSLKSLSYFTS 518

  Fly   755 VKKYCK--RCI 763
            :|:...  ||:
 Worm   519 LKREASVLRCL 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 10/45 (22%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 24/157 (15%)
leucine-rich repeat 476..501 CDD:275381 3/30 (10%)
leucine-rich repeat 502..521 CDD:275381 4/22 (18%)
leucine-rich repeat 528..555 CDD:275381 5/26 (19%)
leucine-rich repeat 556..581 CDD:275381 3/28 (11%)
AMN1 577..746 CDD:187754 41/173 (24%)
leucine-rich repeat 582..607 CDD:275381 4/24 (17%)
leucine-rich repeat 608..633 CDD:275381 8/27 (30%)
leucine-rich repeat 634..659 CDD:275381 5/24 (21%)
leucine-rich repeat 660..685 CDD:275381 3/24 (13%)
leucine-rich repeat 686..710 CDD:275381 9/23 (39%)
leucine-rich repeat 711..735 CDD:275381 4/23 (17%)
leucine-rich repeat 737..761 CDD:275381 6/28 (21%)
Y55F3C.9NP_001343666.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.