DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and CG11044

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster


Alignment Length:407 Identity:84/407 - (20%)
Similarity:143/407 - (35%) Gaps:120/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 LPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWK-------------------------- 442
            |||..:.:||::|...|......|||::....:.|.:|.                          
  Fly    54 LPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDH 118

  Fly   443 -----VISLRGEHLNGDK-----TLKMIFRQLC--------GQSCN------GACPEVERVMLAD 483
                 .:|..|.::.|.:     :...||:.:.        |:..|      |....:..::...
  Fly   119 MRTQFCLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTLVYHF 183

  Fly   484 GCRISD----KGLQL------LTRRCPE----LTHLQLQTCVDI------TNQALVEALTKCS-- 526
            .|.:|.    :|::|      |.|...|    ||.|.....||.      .|..|.|.:..|.  
  Fly   184 PCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDFVLERYEANHLLDEVVCSCCTK 248

  Fly   527 ----NLQHLDVTGCS----------QVSSISPNPHMEPPRRLL----LQYLD-LTDC-----MAI 567
                ||.::....|.          ||.:|||....:....||    |::|. |.:|     :.|
  Fly   249 MRVLNLVNVTTMHCPIMHVGLFLNLQVLTISPQNIDDDVLSLLADTKLRHLHLLQNCYTPSHLTI 313

  Fly   568 DDMGLKI---VVKNCPQL-VYLYLRRCIQVTDAGLKFVP-------SFCVSLKELSVSDCLNITD 621
            ...|:|.   |.|..|:| |:|.|.   .:||..:...|       ::|.....:.....:.:.|
  Fly   314 SACGVKAWRNVKKTNPRLRVHLRLE---NLTDGEVVLQPEAPVHSITYCAPQTRIRAELLVRMVD 375

  Fly   622 FGLYELAKLGAAL--RYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCP 684
            .....||..|..|  |:.|........|:.:.::.|:|:.:..|..|  |.||..::.::|::..
  Fly   376 HYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIR--EKVSTSTLLLIAKTAK 438

  Fly   685 RLRALDIG------KCD 695
            .|:.|.:.      :||
  Fly   439 NLQHLHVRRFAVILRCD 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 13/73 (18%)
leucine-rich repeat 441..460 CDD:275381 4/54 (7%)
AMN1 <451..595 CDD:187754 46/212 (22%)
leucine-rich repeat 476..501 CDD:275381 6/34 (18%)
leucine-rich repeat 502..521 CDD:275381 7/24 (29%)
leucine-rich repeat 528..555 CDD:275381 7/36 (19%)
leucine-rich repeat 556..581 CDD:275381 9/33 (27%)
AMN1 577..746 CDD:187754 30/135 (22%)
leucine-rich repeat 582..607 CDD:275381 8/32 (25%)
leucine-rich repeat 608..633 CDD:275381 4/24 (17%)
leucine-rich repeat 634..659 CDD:275381 6/26 (23%)
leucine-rich repeat 660..685 CDD:275381 6/24 (25%)
leucine-rich repeat 686..710 CDD:275381 4/16 (25%)
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.