DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and fbxl-1

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_741248.1 Gene:fbxl-1 / 3564805 WormBaseID:WBGene00015350 Length:466 Species:Caenorhabditis elegans


Alignment Length:368 Identity:109/368 - (29%)
Similarity:181/368 - (49%) Gaps:29/368 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 LPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQS 468
            ||.|.::::||:||:..||..|:|||.:..||.....|:.:.|    ....:.:|....:...:.
 Worm    60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDL----FTFQRDVKTAVVENLARR 120

  Fly   469 CNGACPEVERVMLADGC-RISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLD 532
            |.|...|:.    ..|| .:.|..|:..|.|||.|.||.|..|..:|:.:.......|..|.:|:
 Worm   121 CGGFLKELS----LKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLN 181

  Fly   533 VTGCSQVSSIS--------PNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRR 589
            :..||.::..:        ||          |.||:::.|.||.|.|::|::.||..|..|.||.
 Worm   182 LENCSSITDRAMKYIGDGCPN----------LSYLNISWCDAIQDRGVQIILSNCKSLDTLILRG 236

  Fly   590 CIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIA 654
            |..:|:.....|.:...::|:|::..|..:||..:..:|....||.||.::.|.::||..|..:.
 Worm   237 CEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLG 301

  Fly   655 RRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCD-VSDAGLRALAESCPNLKKLSLRS 718
            :..:.|:.|...||..:.|:....|||.|.:|..||:..|. :||..:.:||.:|..|::|||..
 Worm   302 QHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSH 366

  Fly   719 CDMITDRGVQCIAYYCR-GLQQLNIQDCPVSIEGYRAVKKYCK 760
            |::|||..:|.:|...| .|..|.:.:||...:...:..::||
 Worm   367 CELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 16/42 (38%)
leucine-rich repeat 441..460 CDD:275381 3/18 (17%)
AMN1 <451..595 CDD:187754 41/152 (27%)
leucine-rich repeat 476..501 CDD:275381 7/25 (28%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 6/34 (18%)
leucine-rich repeat 556..581 CDD:275381 11/24 (46%)
AMN1 577..746 CDD:187754 54/170 (32%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 6/24 (25%)
leucine-rich repeat 634..659 CDD:275381 7/24 (29%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 9/24 (38%)
leucine-rich repeat 711..735 CDD:275381 10/23 (43%)
leucine-rich repeat 737..761 CDD:275381 6/24 (25%)
fbxl-1NP_741248.1 F-box-like 60..101 CDD:372399 16/40 (40%)
AMN1 <121..268 CDD:187754 45/160 (28%)
leucine-rich repeat 125..150 CDD:275381 8/28 (29%)
leucine-rich repeat 151..176 CDD:275381 7/24 (29%)
leucine-rich repeat 177..202 CDD:275381 4/24 (17%)
leucine-rich repeat 203..228 CDD:275381 11/24 (46%)
leucine-rich repeat 229..280 CDD:275381 13/50 (26%)
AMN1 <281..440 CDD:187754 42/129 (33%)
leucine-rich repeat 281..306 CDD:275381 7/24 (29%)
leucine-rich repeat 307..332 CDD:275381 9/24 (38%)
leucine-rich repeat 333..357 CDD:275381 8/23 (35%)
leucine-rich repeat 359..384 CDD:275381 10/24 (42%)
leucine-rich repeat 386..409 CDD:275381 4/22 (18%)
leucine-rich repeat 411..436 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I6923
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2139
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.