DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and CG9316

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:487 Identity:101/487 - (20%)
Similarity:162/487 - (33%) Gaps:144/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 STPTTTPRRGASSNGLGGGAASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWL----DSCEL 421
            |..|..|.|   ||..||...|...|.|    .|.....|.| ||::.:..:..:|    |...|
  Fly    10 SVKTPFPVR---SNRPGGVQKSEPSPSP----SPLCRTSLLD-LPEDIIRLVLEFLPRITDKVLL 66

  Fly   422 CNVARVCR-RFEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGC 485
            ..||...| .||.       |..:......:...:|:.:              |::.|.....| 
  Fly    67 ACVAPKFRAAFEG-------WARVQRNALDMVSLETVPL--------------PQLIRFFKVAG- 109

  Fly   486 RISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTK--CSNLQHLDVTGCSQV----SSISP 544
                          |.:..||:. |.....::|:....|  |.||:.:..:..:..    |.:|.
  Fly   110 --------------PFIRVLQVD-CASYQKESLLVEFVKEYCPNLEEISYSNATDEFHYRSIMSK 159

  Fly   545 NPHMEPPRRLLLQYLDLTDCMAID-----DMGLKIVVKNC---------PQLVYLYLRRCIQVTD 595
            ..|:   :|:.::.||..|.:..|     ::....:|..|         |.|..|.||.|:    
  Fly   160 MTHL---KRVTIECLDAEDVLNFDMQPNQELEFFELVNGCYTGQNLCGFPNLKTLVLRDCL---- 217

  Fly   596 AGLKFVPSFCVSLKELSVSD----CLNITDFGLY-----------ELAKLGAALRYLSVAKCERV 645
              |.....|.:.||.|...|    |..:.:..||           ||...|....:..:|...::
  Fly   218 --LWNSMEFGIPLKSLHTLDLDDCCFEVMNVSLYQKIAESCTNLVELIFSGCDTNFEVIANLPKL 280

  Fly   646 SDAGLK--------------VIA-RRCYKLRYLNARG----------C--------------EAV 671
            ....||              |:| :|..||.:|:..|          |              ..:
  Fly   281 ERCTLKTWMTSNELNIGFLTVLAEKRGNKLTHLHLSGQFNITNEHARCLGQLSSLTDLRFSNNDI 345

  Fly   672 SDDSITVLARSCPRLRALDIGKCD-VSDAGLRALAESCPNLKKLSLRSCDMITDRGV-QCIAYYC 734
            .||..........:|....:..|. |.|.|:..:...||.||.:.|..|:.||:..| |.|.:..
  Fly   346 LDDDHFKFFNDLSQLERFGLTACGRVMDVGMMRMLRKCPQLKVIDLTDCEQITEEFVIQAIGFCS 410

  Fly   735 RGLQQLNIQDCPVSIEGYRAVKKYCKRCIIEH 766
            :|    :.:|..::::|     ...:|.|:.|
  Fly   411 KG----SGRDVVLNVKG-----TMIRRPILTH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 12/50 (24%)
leucine-rich repeat 441..460 CDD:275381 2/18 (11%)
AMN1 <451..595 CDD:187754 29/163 (18%)
leucine-rich repeat 476..501 CDD:275381 2/24 (8%)
leucine-rich repeat 502..521 CDD:275381 4/18 (22%)
leucine-rich repeat 528..555 CDD:275381 5/30 (17%)
leucine-rich repeat 556..581 CDD:275381 6/38 (16%)
AMN1 577..746 CDD:187754 50/233 (21%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 10/39 (26%)
leucine-rich repeat 634..659 CDD:275381 6/39 (15%)
leucine-rich repeat 660..685 CDD:275381 6/48 (13%)
leucine-rich repeat 686..710 CDD:275381 6/24 (25%)
leucine-rich repeat 711..735 CDD:275381 9/24 (38%)
leucine-rich repeat 737..761 CDD:275381 2/23 (9%)
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 6/18 (33%)
leucine-rich repeat 231..258 CDD:275381 5/26 (19%)
leucine-rich repeat 259..279 CDD:275381 4/19 (21%)
leucine-rich repeat 280..309 CDD:275381 5/28 (18%)
AMN1 310..>411 CDD:187754 22/100 (22%)
leucine-rich repeat 310..334 CDD:275381 4/23 (17%)
leucine-rich repeat 335..359 CDD:275381 2/23 (9%)
leucine-rich repeat 360..385 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.