DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and jet

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster


Alignment Length:386 Identity:87/386 - (22%)
Similarity:138/386 - (35%) Gaps:104/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 PRRGASSNGLGGGAASAIGPPPWNRKGPFRCGPLFDRLPDEAVV-RIFSWLDSCELCNV---ARV 427
            |.|.||...|   ..::|..|          ..|||...|:.:: ::..:|...:|.|:   :|.
  Fly    21 PTRTASPRPL---VTASIAAP----------RSLFDVCWDDVLIPQVAVYLSLKDLFNLRCCSRT 72

  Fly   428 CRRFEHLAWRPILWKVISLRGE-HLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKG 491
            .:||...|        :..|.| ||:|:.|..:                             |..
  Fly    73 AQRFVEAA--------LEKRQELHLSGNNTKNI-----------------------------DVA 100

  Fly   492 LQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLL 556
            .::|.|.|..|..|.|..|..:|::.|:..|..                           .:..|
  Fly   101 FRVLARCCQRLEVLHLACCRWLTDELLLPLLAN---------------------------NKKRL 138

  Fly   557 QYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITD 621
            ..::|.:|:.|..:.|:.::..|.:|..|.|.:|..:|...:..:......|.|..:|.|..|.:
  Fly   139 WAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGE 203

  Fly   622 FGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRL 686
            ..|....:....|..||:|....|:|..|..|...|.:|.::|..||.|:||..:..|...|.||
  Fly   204 RCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRL 268

  Fly   687 RALDIGKCDVSDAGLRALAESCPNLKKLS---LRSCDMITDRGVQCIAYYCRGLQQLNIQD 744
            |.|              |...||.:.:||   ||...:..||....:     ||...|:.|
  Fly   269 RTL--------------LIRRCPRVTELSLAPLRQRRLYIDRPQPDV-----GLNAYNLND 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 10/49 (20%)
leucine-rich repeat 441..460 CDD:275381 6/19 (32%)
AMN1 <451..595 CDD:187754 24/143 (17%)
leucine-rich repeat 476..501 CDD:275381 4/24 (17%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 0/26 (0%)
leucine-rich repeat 556..581 CDD:275381 6/24 (25%)
AMN1 577..746 CDD:187754 47/171 (27%)
leucine-rich repeat 582..607 CDD:275381 5/24 (21%)
leucine-rich repeat 608..633 CDD:275381 6/24 (25%)
leucine-rich repeat 634..659 CDD:275381 9/24 (38%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 5/23 (22%)
leucine-rich repeat 711..735 CDD:275381 6/26 (23%)
leucine-rich repeat 737..761 CDD:275381 3/8 (38%)
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 9/53 (17%)
AMN1 96..>261 CDD:187754 44/220 (20%)
leucine-rich repeat 111..137 CDD:275381 7/52 (13%)
leucine-rich repeat 138..163 CDD:275381 6/24 (25%)
leucine-rich repeat 164..189 CDD:275381 5/24 (21%)
leucine-rich repeat 190..215 CDD:275381 6/24 (25%)
leucine-rich repeat 216..241 CDD:275381 9/24 (38%)
leucine-rich repeat 242..267 CDD:275381 9/24 (38%)
leucine-rich repeat 268..290 CDD:275381 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.