DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and fbxl14a

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_958890.1 Gene:fbxl14a / 333988 ZFINID:ZDB-GENE-030131-5920 Length:411 Species:Danio rerio


Alignment Length:383 Identity:100/383 - (26%)
Similarity:176/383 - (45%) Gaps:55/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 EAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHL-------------NGDKTLK 458
            |.:..||::||......||:||..:...::...:|:.:..: .||             .|.|.::
Zfish    11 EILAMIFNYLDVKGKGRVAQVCTAWRDASYHKSVWRGVEAK-LHLRRANPSLFPSLQTRGIKKVQ 74

  Fly   459 MI-FRQLCGQSCNGACPEVERVMLADGC-RISDKGL-QLLTRRCPELTHLQLQTCVDITNQALVE 520
            :: .|:.......| .|.:|.:.|: || .::|.|| ....:..|.|..|.|..|..||:.:|..
Zfish    75 ILSLRRSLSYVIQG-MPNIESLNLS-GCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGR 137

  Fly   521 ALTKCSNLQHLDVTGCSQVSS-----ISPNPHMEPPRRLLLQYLDLTDCMAIDDMGL-------K 573
            ......||:.||:.|||.:::     |:...|.       |:.|:|..|..:.|:|:       :
Zfish   138 IAQYLKNLELLDLGGCSNITNTGLLLIAWGLHN-------LKSLNLRSCRHVSDVGIGHLAGMTR 195

  Fly   574 IVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLS 638
            ...:.|..|.:|.|:.|.::||..||.:......||.|::|.|..|:|.|:..|:.: ..|..|:
Zfish   196 SAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLKVLNLSFCGGISDAGMIHLSHM-TQLWTLN 259

  Fly   639 VAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRA 703
            :..|:.:||.|:..::....:|..|:...|:.|.|.|:..:|:...:|::|.:..|.:||.|:..
Zfish   260 LRSCDNISDTGIMHLSMGALRLYGLDVSFCDKVGDQSLAYIAQGLYQLKSLSLCSCHISDDGINR 324

  Fly   704 LAESCPNLKKLSLRSCDMITDRGVQCIA-----------YYC-----RGLQQLNIQDC 745
            :......||.|::..|..|||:|::.||           |.|     |||:::....|
Zfish   325 MVRQMHELKTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKITKRGLERITQLPC 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 10/39 (26%)
leucine-rich repeat 441..460 CDD:275381 5/31 (16%)
AMN1 <451..595 CDD:187754 41/171 (24%)
leucine-rich repeat 476..501 CDD:275381 7/26 (27%)
leucine-rich repeat 502..521 CDD:275381 7/18 (39%)
leucine-rich repeat 528..555 CDD:275381 8/31 (26%)
leucine-rich repeat 556..581 CDD:275381 7/31 (23%)
AMN1 577..746 CDD:187754 53/185 (29%)
leucine-rich repeat 582..607 CDD:275381 8/24 (33%)
leucine-rich repeat 608..633 CDD:275381 9/24 (38%)
leucine-rich repeat 634..659 CDD:275381 6/24 (25%)
leucine-rich repeat 660..685 CDD:275381 7/24 (29%)
leucine-rich repeat 686..710 CDD:275381 6/23 (26%)
leucine-rich repeat 711..735 CDD:275381 12/39 (31%)
leucine-rich repeat 737..761 CDD:275381 2/9 (22%)
fbxl14aNP_958890.1 F-box-like 5..46 CDD:289689 9/34 (26%)
AMN1 90..243 CDD:187754 46/160 (29%)
leucine-rich repeat 92..118 CDD:275381 7/26 (27%)
leucine-rich repeat 119..144 CDD:275381 7/24 (29%)
leucine-rich repeat 145..170 CDD:275381 7/24 (29%)
leucine-rich repeat 171..203 CDD:275381 7/31 (23%)
leucine-rich repeat 204..229 CDD:275381 8/24 (33%)
AMN1 230..397 CDD:187754 44/154 (29%)
leucine-rich repeat 230..254 CDD:275381 9/24 (38%)
leucine-rich repeat 255..280 CDD:275381 6/24 (25%)
leucine-rich repeat 281..304 CDD:275381 7/22 (32%)
leucine-rich repeat 307..331 CDD:275381 6/23 (26%)
leucine-rich repeat 332..357 CDD:275381 10/24 (42%)
leucine-rich repeat 358..377 CDD:275381 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.