DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl12

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_006242701.1 Gene:Fbxl12 / 313782 RGDID:1305528 Length:326 Species:Rattus norvegicus


Alignment Length:392 Identity:85/392 - (21%)
Similarity:149/392 - (38%) Gaps:110/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 LFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLA-----WRPILWKVISLRGEHLNGDKTLKM 459
            ||| |||..::.|||:|...:...::|||.|::.|.     ||.:...:.::|      .|.:..
  Rat     4 LFD-LPDLVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMR------PKVMWH 61

  Fly   460 IFR----------QLCGQSCNGA-CPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDI 513
            :.|          ::.|...:|: .|::...:           ::.|.::||.|..|    |:.:
  Rat    62 LLRRYMASRLHSLRMGGYLFSGSQAPQLSPAL-----------MRALGQKCPNLKRL----CLHV 111

  Fly   514 TNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKN 578
            .:.::|...:..|.|:.|::..| ::|.|......:|      ..|.|.:|:.:|.         
  Rat   112 ADLSMVPITSLPSTLRTLELHSC-EISMIWLQKEQDP------TVLPLLECIVLDR--------- 160

  Fly   579 CPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCE 643
                                  ||:|               .|..|..|.:. .|||.|.:....
  Rat   161 ----------------------VPAF---------------RDEHLQGLTRF-RALRSLVLGGTY 187

  Fly   644 RVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRA----L 704
            ||::.||....:....|:.|...||...:|.::..::|   .||  |:.|..::..||.|    .
  Rat   188 RVTETGLDSSLQELSYLQRLEVLGCTLSADSTLLAISR---HLR--DVRKIRLTVGGLSAQGLVF 247

  Fly   705 AESCPNLKKL----SLRSCDMITDRGVQCIAYYCRGLQQLNIQDCPVSIEGYRAVKKYCK---RC 762
            .|..|.|:.|    .|.:.:|.|...:.........|:.|.:|.  :..||..|.|..||   .|
  Rat   248 LEGMPVLESLCFQGPLITPEMPTPAQIVSSCLTMPKLRVLEVQG--LGWEGQEAEKVLCKGLPHC 310

  Fly   763 II 764
            ::
  Rat   311 LV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 16/50 (32%)
leucine-rich repeat 441..460 CDD:275381 2/18 (11%)
AMN1 <451..595 CDD:187754 23/154 (15%)
leucine-rich repeat 476..501 CDD:275381 2/24 (8%)
leucine-rich repeat 502..521 CDD:275381 4/18 (22%)
leucine-rich repeat 528..555 CDD:275381 6/26 (23%)
leucine-rich repeat 556..581 CDD:275381 4/24 (17%)
AMN1 577..746 CDD:187754 37/176 (21%)
leucine-rich repeat 582..607 CDD:275381 3/24 (13%)
leucine-rich repeat 608..633 CDD:275381 3/24 (13%)
leucine-rich repeat 634..659 CDD:275381 7/24 (29%)
leucine-rich repeat 660..685 CDD:275381 6/24 (25%)
leucine-rich repeat 686..710 CDD:275381 8/27 (30%)
leucine-rich repeat 711..735 CDD:275381 5/27 (19%)
leucine-rich repeat 737..761 CDD:275381 9/26 (35%)
Fbxl12XP_006242701.1 F-box-like 4..48 CDD:403981 17/44 (39%)
leucine-rich repeat 104..125 CDD:275381 4/24 (17%)
AMN1 121..>226 CDD:187754 31/161 (19%)
leucine-rich repeat 126..152 CDD:275381 7/32 (22%)
leucine-rich repeat 153..177 CDD:275381 8/70 (11%)
leucine-rich repeat 178..203 CDD:275381 7/24 (29%)
leucine-rich repeat 204..229 CDD:275381 8/29 (28%)
leucine-rich repeat 230..253 CDD:275381 5/22 (23%)
leucine-rich repeat 254..283 CDD:275381 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.