DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl4

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001382505.1 Gene:Fbxl4 / 313101 RGDID:1305724 Length:621 Species:Rattus norvegicus


Alignment Length:380 Identity:105/380 - (27%)
Similarity:165/380 - (43%) Gaps:75/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 AASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCR----------RFEHL 434
            :::.:|..|.|        ..||:||.|.:..|.:.|...:||.:|:.||          ::.||
  Rat   267 SSATLGDGPSN--------GYFDKLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHL 323

  Fly   435 AWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLA-DGCR--ISDKGLQLLT 496
            ..:| .|..:.        |.:|:.:         ...|..|:.:.|: .|.|  ||..|.....
  Rat   324 NLQP-YWAKLD--------DTSLEFL---------QARCALVQWLNLSWTGNRGFISVSGFSRFL 370

  Fly   497 RRC-PELTHLQLQTCVDITNQALVEALTK-CSNLQHLDVTGCSQVSSISPNPHMEPP-------- 551
            :.| .||..|:| :|....|.|.:|.::: |.|||.|:::.|.::          ||        
  Rat   371 KVCGSELVRLEL-SCSHFLNDACLEVISEMCPNLQDLNLSSCDKL----------PPQAFGHIAK 424

  Fly   552 ----RRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGL--KFVPSFCVSLKE 610
                :||:|..      ..::...|..::..|.:|.:|.|..|:.:.|..:  ..:.:.|.||:.
  Rat   425 LRSLKRLILYR------TKVEQTALLSILNFCAELQHLSLGSCVMIEDYDVIASMIGAKCKSLRT 483

  Fly   611 LSVSDCLNITDFGLYELAKLGAALRYLSVAKCERV-SDAG-LKVIARRCYKLRYLNARGCEAVSD 673
            |.:..|.|||:.|:.|||...|.|..|.:..|..: |..| ...:||:...|:.|......:|.|
  Rat   484 LDLWRCKNITENGIAELASGCALLEELDLGWCPTLQSSTGCFARLARQLPNLQKLFLTANRSVCD 548

  Fly   674 DSITVLARSCPRLRALDI-GKCDVSDAGLRALAESCPNLKKLSLRSCDMITDRGV 727
            ..|..||.:|.||:.||| |...||.|.||.|.|||.:|..|.:..|..|.:|.|
  Rat   549 TDIEELASNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAV 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 16/55 (29%)
leucine-rich repeat 441..460 CDD:275381 3/18 (17%)
AMN1 <451..595 CDD:187754 36/160 (23%)
leucine-rich repeat 476..501 CDD:275381 8/28 (29%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 7/38 (18%)
leucine-rich repeat 556..581 CDD:275381 3/24 (13%)
AMN1 577..746 CDD:187754 55/156 (35%)
leucine-rich repeat 582..607 CDD:275381 6/26 (23%)
leucine-rich repeat 608..633 CDD:275381 10/24 (42%)
leucine-rich repeat 634..659 CDD:275381 7/26 (27%)
leucine-rich repeat 660..685 CDD:275381 8/24 (33%)
leucine-rich repeat 686..710 CDD:275381 14/24 (58%)
leucine-rich repeat 711..735 CDD:275381 6/17 (35%)
leucine-rich repeat 737..761 CDD:275381
Fbxl4NP_001382505.1 F-box-like 280..318 CDD:403981 12/37 (32%)
leucine-rich repeat 295..317 CDD:275381 6/21 (29%)
leucine-rich repeat 318..340 CDD:275381 6/30 (20%)
leucine-rich repeat 347..376 CDD:275381 8/28 (29%)
leucine-rich repeat 377..402 CDD:275381 8/25 (32%)
AMN1 394..601 CDD:187754 66/222 (30%)
leucine-rich repeat 403..427 CDD:275381 6/33 (18%)
leucine-rich repeat 428..452 CDD:275381 5/29 (17%)
leucine-rich repeat 453..480 CDD:275381 6/26 (23%)
leucine-rich repeat 481..506 CDD:275381 10/24 (42%)
leucine-rich repeat 507..534 CDD:275381 7/26 (27%)
leucine-rich repeat 535..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..586 CDD:275381 14/24 (58%)
leucine-rich repeat 587..612 CDD:275381 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.