DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl15

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001101073.1 Gene:Fbxl15 / 309453 RGDID:1306444 Length:300 Species:Rattus norvegicus


Alignment Length:351 Identity:89/351 - (25%)
Similarity:135/351 - (38%) Gaps:96/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PPWNRKGPFRCGP-------LFDRLPDEAVV--RIFSWLDSCELCNVARVCRRFE-----HLAWR 437
            ||..:.|    |.       |.| ||.|.|:  .:.:|:...:|..:.||.|.|.     |||  
  Rat     3 PPMEQSG----GEQEPGAVRLLD-LPWEDVLLPHVLNWVPLRQLLRLQRVSRAFRALVQLHLA-- 60

  Fly   438 PILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPEL 502
                              .|:.......|       |::.|..|.           .|.|....|
  Rat    61 ------------------RLRRFDAAQVG-------PQIPRAALV-----------RLLRDAEGL 89

  Fly   503 THLQLQTCVD-ITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMA 566
            ..|.|..|.: :.::.||..|.:...|:.:.:.||.|:|           ||             
  Rat    90 QELALAPCHEWLLDEDLVPVLARNPQLRSVALAGCGQLS-----------RR------------- 130

  Fly   567 IDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELA-KL 630
                .|..:.:.||:|..:.|..|..|....|:.:...|.:|:||.::.|..:.|..:..|| :.
  Rat   131 ----ALGALAEGCPRLQRISLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRR 191

  Fly   631 GAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCD 695
            ||.||.||:|....|.|..::.:||.|.:|.:|:..||..|..|.:..||..||.||:|.:..| 
  Rat   192 GAGLRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPALRSLRVRHC- 255

  Fly   696 VSDAGLRALAESCPNLKKLSLRSCDM 721
                  ..:||  |:|.:|..|..|:
  Rat   256 ------HHVAE--PSLSRLRKRGVDI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 14/52 (27%)
leucine-rich repeat 441..460 CDD:275381 1/18 (6%)
AMN1 <451..595 CDD:187754 28/144 (19%)
leucine-rich repeat 476..501 CDD:275381 4/24 (17%)
leucine-rich repeat 502..521 CDD:275381 6/19 (32%)
leucine-rich repeat 528..555 CDD:275381 7/26 (27%)
leucine-rich repeat 556..581 CDD:275381 2/24 (8%)
AMN1 577..746 CDD:187754 48/146 (33%)
leucine-rich repeat 582..607 CDD:275381 6/24 (25%)
leucine-rich repeat 608..633 CDD:275381 8/25 (32%)
leucine-rich repeat 634..659 CDD:275381 10/24 (42%)
leucine-rich repeat 660..685 CDD:275381 9/24 (38%)
leucine-rich repeat 686..710 CDD:275381 6/23 (26%)
leucine-rich repeat 711..735 CDD:275381 4/11 (36%)
leucine-rich repeat 737..761 CDD:275381
Fbxl15NP_001101073.1 F-box 18..55 CDD:395521 12/37 (32%)
leucine-rich repeat 62..88 CDD:275381 7/43 (16%)
leucine-rich repeat 89..115 CDD:275381 7/25 (28%)
Interaction with SMURF1. /evidence=ECO:0000250 113..269 54/192 (28%)
leucine-rich repeat 116..141 CDD:275381 9/52 (17%)
AMN1 <139..>268 CDD:187754 46/137 (34%)
leucine-rich repeat 142..167 CDD:275381 6/24 (25%)
leucine-rich repeat 168..194 CDD:275381 8/25 (32%)
leucine-rich repeat 195..220 CDD:275381 10/24 (42%)
leucine-rich repeat 221..245 CDD:275381 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.