DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl12

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:401 Identity:87/401 - (21%)
Similarity:148/401 - (36%) Gaps:108/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 PPPWNR-KGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLA-----WRPILWKVI 444
            |..|.: ||..|.|...  ||.:.::     |.....|   |||.|::.|.     ||.:...:.
Mouse    21 PSSWKKPKGSQRRGARL--LPSQTIL-----LPRNPGC---RVCHRWKRLVDDRWLWRHVDLTLY 75

  Fly   445 SLRGE---HLNGDKTLKMIFR-QLCGQSCNGA-CPEVERVMLADGCRISDKGLQLLTRRCPELTH 504
            ::|.:   ||........::. ::.|...:|: .|::...:           ::.|.::||.|..
Mouse    76 TMRPKVMWHLLRRYMASRLYSLRMGGYLFSGSQAPQLSPAL-----------MRALGQKCPNLKR 129

  Fly   505 LQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDD 569
            |    |:.:.:.::|...:..|.|:.|::..| ::|.|......:|      ..|.|.:|:.:|.
Mouse   130 L----CLHVADLSMVPITSLPSTLRTLELHSC-EISMIWLQKEQDP------TVLPLLECIVLDR 183

  Fly   570 MGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAAL 634
                                           ||:|               .|..|..|.:. .||
Mouse   184 -------------------------------VPAF---------------RDEHLQGLTRF-RAL 201

  Fly   635 RYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDA 699
            |.|.:....||::.||....:....|:.|...||...:|.::..::|   .||  |:.|..::..
Mouse   202 RSLVLGGTYRVTETGLDASLQELSYLQRLEVLGCTLSADSTLLAISR---HLR--DVRKIRLTVG 261

  Fly   700 GLRA----LAESCPNLKKL----SLRSCDMITDRGVQCIAYYCRGLQQLNIQDCPVSIEGYRAVK 756
            ||.|    ..|..|.|:.|    .|.:.||.|...:.........|:.|.:|.  :..||..|.|
Mouse   262 GLSAQGLVFLEGMPVLESLCFQGPLITPDMPTPTQIVSSCLTMPKLRVLEVQG--LGWEGQEAEK 324

  Fly   757 KYCK---RCII 764
            ..||   .||:
Mouse   325 ILCKGLPHCIV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 11/50 (22%)
leucine-rich repeat 441..460 CDD:275381 3/21 (14%)
AMN1 <451..595 CDD:187754 22/145 (15%)
leucine-rich repeat 476..501 CDD:275381 2/24 (8%)
leucine-rich repeat 502..521 CDD:275381 4/18 (22%)
leucine-rich repeat 528..555 CDD:275381 6/26 (23%)
leucine-rich repeat 556..581 CDD:275381 4/24 (17%)
AMN1 577..746 CDD:187754 38/176 (22%)
leucine-rich repeat 582..607 CDD:275381 3/24 (13%)
leucine-rich repeat 608..633 CDD:275381 3/24 (13%)
leucine-rich repeat 634..659 CDD:275381 7/24 (29%)
leucine-rich repeat 660..685 CDD:275381 6/24 (25%)
leucine-rich repeat 686..710 CDD:275381 8/27 (30%)
leucine-rich repeat 711..735 CDD:275381 6/27 (22%)
leucine-rich repeat 737..761 CDD:275381 9/26 (35%)
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689 8/24 (33%)
leucine-rich repeat 127..148 CDD:275381 4/24 (17%)
AMN1 144..>249 CDD:187754 31/161 (19%)
leucine-rich repeat 149..175 CDD:275381 7/32 (22%)
leucine-rich repeat 176..200 CDD:275381 8/70 (11%)
leucine-rich repeat 201..226 CDD:275381 7/24 (29%)
leucine-rich repeat 227..252 CDD:275381 8/29 (28%)
leucine-rich repeat 253..276 CDD:275381 5/22 (23%)
leucine-rich repeat 277..306 CDD:275381 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.