DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl21

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:446 Identity:92/446 - (20%)
Similarity:161/446 - (36%) Gaps:115/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 IMASSTPTTTPRRGASSNGLGGGAASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCEL 421
            ::.||.....|:||..::.......||:  ..|.            .||...::|||.:|...:.
  Rat    38 VVHSSPAVKQPKRGLCTSLRQTQMLSAL--LDWG------------TLPHHVILRIFQYLPLVDR 88

  Fly   422 CNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCR 486
            ...:.|||.:..:...|.||:....   .||...|  ..|:        ...|::.:        
  Rat    89 ARASSVCRSWNEVFHIPDLWRKFEF---ELNQSAT--SYFK--------STHPDLIQ-------- 132

  Fly   487 ISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPP 551
                  |::.:....|.::..:  ||.:.::...|....|.|.:..:.....:|:..|: .|..|
  Rat   133 ------QIIKKHAAHLQYVSFK--VDSSTESAEAACHILSQLVNCSIQTLGLISTAKPS-FMNMP 188

  Fly   552 RRLLLQYLDLT------------DCMAIDDMGLKIVV-KNCPQLVYLYLRRCIQVTDAGLKFVPS 603
            :...:..|.:.            :...:||..|||:| .|...|..|.:..|..|:..|:..|..
  Rat   189 KSHFVSALTVVFVNSKSLSSIKIEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVAD 253

  Fly   604 FCVSLKELS-----VSDCL----------NITDFGLYELAKLGAALRYLSVAKCERVSDA----- 648
            .|..|:||:     :||.|          |:....:..:::....:::.|:.|..  .||     
  Rat   254 HCQGLRELALNYYILSDELLLALSSETHVNLEHLRIDVVSENPGQIKFHSIKKPS--WDALVKHS 316

  Fly   649 -GLKVIARRCYKLRYLNARGCEAVSDD-----------------SITVLAR---SCPRLRALDIG 692
             |:.|:   .|...|      |...|.                 |.|:|.|   :||||  :::.
  Rat   317 PGVNVV---MYFFLY------EEEFDTFFKEETPVTHLYFGRSVSRTILGRIGLNCPRL--IELV 370

  Fly   693 KC----DVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQD 744
            .|    ...|:.|..:||.|.||..|.|..|::.....|:.:....|.|.||::.:
  Rat   371 VCANGLQPLDSELIRIAEHCKNLTALGLSECEVSCSAFVEFVRLCGRRLTQLSLME 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 12/45 (27%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 28/156 (18%)
leucine-rich repeat 476..501 CDD:275381 1/24 (4%)
leucine-rich repeat 502..521 CDD:275381 3/18 (17%)
leucine-rich repeat 528..555 CDD:275381 5/26 (19%)
leucine-rich repeat 556..581 CDD:275381 8/37 (22%)
AMN1 577..746 CDD:187754 49/213 (23%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 7/39 (18%)
leucine-rich repeat 634..659 CDD:275381 6/30 (20%)
leucine-rich repeat 660..685 CDD:275381 8/44 (18%)
leucine-rich repeat 686..710 CDD:275381 7/27 (26%)
leucine-rich repeat 711..735 CDD:275381 5/23 (22%)
leucine-rich repeat 737..761 CDD:275381 3/8 (38%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 13/54 (24%)
leucine-rich repeat 206..231 CDD:275381 7/24 (29%)
leucine-rich repeat 232..257 CDD:275381 7/24 (29%)
leucine-rich repeat 258..283 CDD:275381 6/24 (25%)
leucine-rich repeat 284..318 CDD:275381 4/35 (11%)
leucine-rich repeat 329..365 CDD:275381 7/35 (20%)
AMN1 <359..>424 CDD:187754 20/66 (30%)
leucine-rich repeat 366..392 CDD:275381 7/27 (26%)
leucine-rich repeat 393..418 CDD:275381 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.