DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and Fbxl3

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001094038.1 Gene:Fbxl3 / 306129 RGDID:1305660 Length:428 Species:Rattus norvegicus


Alignment Length:408 Identity:84/408 - (20%)
Similarity:141/408 - (34%) Gaps:119/408 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 LPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQLCGQS 468
            |..:.|:.:|.:|...:..:.::|||.:..:...|.||:....   .||...|..:         
  Rat    39 LLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEF---ELNQPATSYL--------- 91

  Fly   469 CNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDV 533
             ....||:.:              |::.|....|.::..:  ||.:.::...|....|.|.:..:
  Rat    92 -KATHPELIK--------------QIIKRHSNHLQYVSFK--VDSSKESAEAACDILSQLVNCSL 139

  Fly   534 TGCSQVSSISPNPHMEPPRRLLLQYLDLT------------DCMAIDDMGLKIVV-KNCPQLVYL 585
            .....:|:..|: .|:.|:...:..|.:.            |...:||..||::| .|...|..|
  Rat   140 KTLGLISTARPS-FMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLL 203

  Fly   586 YLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGL 650
            .:..|..|:.||:..|...|..|:||:::          |.|.. ...|..||..|..|:....:
  Rat   204 KMSSCPHVSPAGILCVADQCHGLRELALN----------YHLLS-DELLLALSSEKHVRLEHLRI 257

  Fly   651 KVIARR-----------------------------------------CYKLRYLNARGCEAVSDD 674
            .|::..                                         .|::...:.....:||.|
  Rat   258 DVVSENPGQTHFHTIQKSSWDAFIKHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKD 322

  Fly   675 SITVLARSCPRLRALDIGKCDVSDAGLRAL-------AESCPNLKKLSLRSCDMITDRGVQCIAY 732
            .:..:..:||||..|     .|...|||.|       ||.|.||..:.|..|:      |.|.|:
  Rat   323 VLGRVGMTCPRLVEL-----VVCANGLRPLDEELIRIAERCKNLSAIGLGECE------VSCSAF 376

  Fly   733 -----YCRG-LQQLNIQD 744
                 .|.| |.||:|.:
  Rat   377 VEFVKMCGGRLSQLSIME 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 10/42 (24%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 29/156 (19%)
leucine-rich repeat 476..501 CDD:275381 2/24 (8%)
leucine-rich repeat 502..521 CDD:275381 3/18 (17%)
leucine-rich repeat 528..555 CDD:275381 5/26 (19%)
leucine-rich repeat 556..581 CDD:275381 8/37 (22%)
AMN1 577..746 CDD:187754 50/222 (23%)
leucine-rich repeat 582..607 CDD:275381 8/24 (33%)
leucine-rich repeat 608..633 CDD:275381 5/24 (21%)
leucine-rich repeat 634..659 CDD:275381 6/65 (9%)
leucine-rich repeat 660..685 CDD:275381 4/24 (17%)
leucine-rich repeat 686..710 CDD:275381 10/30 (33%)
leucine-rich repeat 711..735 CDD:275381 6/28 (21%)
leucine-rich repeat 737..761 CDD:275381 4/8 (50%)
Fbxl3NP_001094038.1 F-box-like 36..77 CDD:403981 9/37 (24%)
leucine-rich repeat 174..199 CDD:275381 7/24 (29%)
leucine-rich repeat 200..225 CDD:275381 8/24 (33%)
leucine-rich repeat 252..286 CDD:275381 1/33 (3%)
leucine-rich repeat 287..333 CDD:275381 5/45 (11%)
leucine-rich repeat 334..360 CDD:275381 10/30 (33%)
leucine-rich repeat 361..383 CDD:275381 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.