| Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001106873.1 | Gene: | AMN1 / 196394 | HGNCID: | 27281 | Length: | 258 | Species: | Homo sapiens |
| Alignment Length: | 223 | Identity: | 67/223 - (30%) |
|---|---|---|---|
| Similarity: | 99/223 - (44%) | Gaps: | 42/223 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 540 SSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRC----IQVTDAGLKF 600
Fly 601 VPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNA 665
Fly 666 RGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESCPNLKKLS---LRSCDMITDRGV 727
Fly 728 QCIAYYCRGLQQLNIQDCPVSIEGYRAV 755 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
| leucine-rich repeat | 441..460 | CDD:275381 | |||
| AMN1 | <451..595 | CDD:187754 | 19/58 (33%) | ||
| leucine-rich repeat | 476..501 | CDD:275381 | |||
| leucine-rich repeat | 502..521 | CDD:275381 | |||
| leucine-rich repeat | 528..555 | CDD:275381 | 5/14 (36%) | ||
| leucine-rich repeat | 556..581 | CDD:275381 | 10/24 (42%) | ||
| AMN1 | 577..746 | CDD:187754 | 50/175 (29%) | ||
| leucine-rich repeat | 582..607 | CDD:275381 | 10/28 (36%) | ||
| leucine-rich repeat | 608..633 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 634..659 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 660..685 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 686..710 | CDD:275381 | 9/23 (39%) | ||
| leucine-rich repeat | 711..735 | CDD:275381 | 8/26 (31%) | ||
| leucine-rich repeat | 737..761 | CDD:275381 | 5/19 (26%) | ||
| AMN1 | NP_001106873.1 | AMN1 | 37..257 | CDD:187754 | 67/223 (30%) |
| leucine-rich repeat | 63..86 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 87..116 | CDD:275381 | 10/28 (36%) | ||
| leucine-rich repeat | 117..142 | CDD:275381 | 10/50 (20%) | ||
| leucine-rich repeat | 143..168 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 169..195 | CDD:275381 | 10/26 (38%) | ||
| leucine-rich repeat | 196..221 | CDD:275381 | 7/24 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||