Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359968.1 | Gene: | Y9C9A.13 / 189418 | WormBaseID: | WBGene00021180 | Length: | 635 | Species: | Caenorhabditis elegans |
Alignment Length: | 270 | Identity: | 59/270 - (21%) |
---|---|---|---|
Similarity: | 105/270 - (38%) | Gaps: | 85/270 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 502 LTHLQLQTCVDITNQALV---EALTK---------------------CSNLQHLDVTG------- 535
Fly 536 -CSQVSSISPNPHMEPPRRLLLQYLDLTDCM--AIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAG 597
Fly 598 LK--FVPSFCVSLKELSVSDCLNITDFG-LYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYK 659
Fly 660 LRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESCPNLKKLSLRSCDMITD 724
Fly 725 R--GVQCIAY 732 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
leucine-rich repeat | 441..460 | CDD:275381 | |||
AMN1 | <451..595 | CDD:187754 | 21/126 (17%) | ||
leucine-rich repeat | 476..501 | CDD:275381 | |||
leucine-rich repeat | 502..521 | CDD:275381 | 5/21 (24%) | ||
leucine-rich repeat | 528..555 | CDD:275381 | 5/34 (15%) | ||
leucine-rich repeat | 556..581 | CDD:275381 | 8/26 (31%) | ||
AMN1 | 577..746 | CDD:187754 | 40/161 (25%) | ||
leucine-rich repeat | 582..607 | CDD:275381 | 3/26 (12%) | ||
leucine-rich repeat | 608..633 | CDD:275381 | 10/25 (40%) | ||
leucine-rich repeat | 634..659 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 660..685 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 686..710 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 711..735 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 737..761 | CDD:275381 | |||
Y9C9A.13 | NP_001359968.1 | internalin_A | 100..>340 | CDD:380193 | 52/243 (21%) |
leucine-rich repeat | 123..148 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 149..173 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 174..195 | CDD:275381 | 3/29 (10%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162672 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |