DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and F53G2.1

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_494284.1 Gene:F53G2.1 / 186184 WormBaseID:WBGene00018766 Length:714 Species:Caenorhabditis elegans


Alignment Length:273 Identity:57/273 - (20%)
Similarity:112/273 - (41%) Gaps:79/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 NLQHLDVTGCSQVSS-----ISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLK----------IVV 576
            |||.||::|..:.|:     |.   ||.|               ::..:.::          :|.
 Worm   122 NLQTLDLSGKEEFSTGWTVKIG---HMFP---------------SLTTLSIRGRTLYKKEFLVVC 168

  Fly   577 KNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAK 641
            :|.|:|:.|    .|..|:..|.|..|:.:.|:||::.:...::.|...:|..| :.|.:|.:::
 Worm   169 QNFPKLISL----DISDTNVQLLFGISYLIHLRELTMQNLTFLSHFVWLDLFHL-SGLEFLDISR 228

  Fly   642 CERVSDAGLKVIARRCY--------KLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSD 698
            .:...|  :|.:  |.|        .||:|:..|.: :.|..:..|..|.|:|:.:    | |.|
 Worm   229 DKLNKD--MKTV--RQYVDCGMGLSNLRFLDCSGTD-IDDQLVQCLQLSHPKLKQI----C-VFD 283

  Fly   699 AGLRALAESCPNLKKLSLRSCDMIT------DRGVQCIAYYCRGLQQLNIQDC--PVSIEGYRAV 755
            :          .|::.:::|..|:|      ...:.|:.|:....::..:..|  .::...|.. 
 Worm   284 S----------VLQRSTIQSAGMMTLNTATLGSSLNCLNYFVARRKEYAVWKCLKEINTHVYNT- 337

  Fly   756 KKYCKRCIIEHTN 768
                |...:.|||
 Worm   338 ----KDDELNHTN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689
leucine-rich repeat 441..460 CDD:275381
AMN1 <451..595 CDD:187754 17/82 (21%)
leucine-rich repeat 476..501 CDD:275381
leucine-rich repeat 502..521 CDD:275381
leucine-rich repeat 528..555 CDD:275381 10/31 (32%)
leucine-rich repeat 556..581 CDD:275381 2/34 (6%)
AMN1 577..746 CDD:187754 40/184 (22%)
leucine-rich repeat 582..607 CDD:275381 7/24 (29%)
leucine-rich repeat 608..633 CDD:275381 6/24 (25%)
leucine-rich repeat 634..659 CDD:275381 6/32 (19%)
leucine-rich repeat 660..685 CDD:275381 7/24 (29%)
leucine-rich repeat 686..710 CDD:275381 4/23 (17%)
leucine-rich repeat 711..735 CDD:275381 6/29 (21%)
leucine-rich repeat 737..761 CDD:275381 2/25 (8%)
F53G2.1NP_494284.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.