| Sequence 1: | NP_650512.1 | Gene: | Fbxl7 / 41935 | FlyBaseID: | FBgn0038385 | Length: | 772 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_496512.2 | Gene: | F44E5.2 / 185735 | WormBaseID: | WBGene00009689 | Length: | 489 | Species: | Caenorhabditis elegans |
| Alignment Length: | 244 | Identity: | 44/244 - (18%) |
|---|---|---|---|
| Similarity: | 84/244 - (34%) | Gaps: | 82/244 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 564 CMAIDDMGLKIVVKN--------C--PQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLN 618
Fly 619 ITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRC-------------------------- 657
Fly 658 --------------YKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESC 708
Fly 709 PNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDCPVSIEGYRAVKK 757 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fbxl7 | NP_650512.1 | F-box-like | 401..447 | CDD:289689 | |
| leucine-rich repeat | 441..460 | CDD:275381 | |||
| AMN1 | <451..595 | CDD:187754 | 7/40 (18%) | ||
| leucine-rich repeat | 476..501 | CDD:275381 | |||
| leucine-rich repeat | 502..521 | CDD:275381 | |||
| leucine-rich repeat | 528..555 | CDD:275381 | |||
| leucine-rich repeat | 556..581 | CDD:275381 | 6/26 (23%) | ||
| AMN1 | 577..746 | CDD:187754 | 38/218 (17%) | ||
| leucine-rich repeat | 582..607 | CDD:275381 | 2/24 (8%) | ||
| leucine-rich repeat | 608..633 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 634..659 | CDD:275381 | 5/64 (8%) | ||
| leucine-rich repeat | 660..685 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 686..710 | CDD:275381 | 4/23 (17%) | ||
| leucine-rich repeat | 711..735 | CDD:275381 | 4/23 (17%) | ||
| leucine-rich repeat | 737..761 | CDD:275381 | 6/21 (29%) | ||
| F44E5.2 | NP_496512.2 | leucine-rich repeat | 123..148 | CDD:275380 | 7/24 (29%) |
| leucine-rich repeat | 149..173 | CDD:275380 | 4/23 (17%) | ||
| LRR_4 | 172..215 | CDD:289563 | 12/49 (24%) | ||
| leucine-rich repeat | 174..195 | CDD:275380 | 4/24 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160162677 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||