DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and T28B4.1

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001024931.1 Gene:T28B4.1 / 180930 WormBaseID:WBGene00020884 Length:552 Species:Caenorhabditis elegans


Alignment Length:377 Identity:89/377 - (23%)
Similarity:151/377 - (40%) Gaps:90/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 PLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEHLNGDKTLKMIFRQ 463
            |..::|||:.:..||.:|...::..|..||:|:...:..|:|||.:|.|..:             
 Worm    64 PTIEKLPDKVLRDIFQYLSPKQINQVGLVCKRWRVTSQNPLLWKFVSFRPNY------------- 115

  Fly   464 LCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNL 528
             .|...|..|              .|..:||:..|..||..::|.|.: ||...|.|...|...|
 Worm   116 -GGIQVNPQC--------------IDHFIQLIGTRFSELRIVELATDL-ITPNVLYELANKAPKL 164

  Fly   529 QHL-----------DVTGCSQVSS--------ISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKI 574
            |:|           |.|......|        :|.|..:|...|.:..::...:.:.|  :|...
 Worm   165 QYLTLDFSTAMQLHDFTDLQSFPSRLKSLTLCLSENIFLEGFLRKVYTFISSVETLHI--IGTYE 227

  Fly   575 VVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSV 639
            .|::..:.||    ..:.|..     :..|..:|:.:::.....|||..:..::...|.|..|.|
 Worm   228 KVEDEEEEVY----ETVNVFK-----LKQFLPNLRVVNLWGVPFITDEHVDAISSNCAHLECLCV 283

  Fly   640 AKCERVSDAGLKVIARRCYKLR-------------------------YLNARGCEAVSDDSITVL 679
            ..|.:|:.:.||::.:||.||:                         .|:.:|.|..||..|::|
 Worm   284 NYCPKVTGSCLKLVLQRCRKLKTLFLAHTKLDNNIVKMVDWEKTRIEELDIKGTELNSDALISIL 348

  Fly   680 ARSCPRLRALDIG--KCDVSDAGLRALAES--CPNLKKLSLRSCDMITDRGV 727
            .| .|.||.||..  :| ::|..|.|...|  ..:|:.|::.:||.|.::.:
 Worm   349 TR-LPHLRWLDASWLEC-MTDQVLEAWQNSNAMGSLQFLNMDTCDSINEQAL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 15/45 (33%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
AMN1 <451..595 CDD:187754 32/162 (20%)
leucine-rich repeat 476..501 CDD:275381 4/24 (17%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 10/45 (22%)
leucine-rich repeat 556..581 CDD:275381 3/24 (13%)
AMN1 577..746 CDD:187754 43/180 (24%)
leucine-rich repeat 582..607 CDD:275381 4/24 (17%)
leucine-rich repeat 608..633 CDD:275381 4/24 (17%)
leucine-rich repeat 634..659 CDD:275381 9/24 (38%)
leucine-rich repeat 660..685 CDD:275381 9/49 (18%)
leucine-rich repeat 686..710 CDD:275381 9/27 (33%)
leucine-rich repeat 711..735 CDD:275381 5/17 (29%)
leucine-rich repeat 737..761 CDD:275381
T28B4.1NP_001024931.1 F-box-like 66..110 CDD:372399 14/43 (33%)
leucine-rich repeat 139..163 CDD:275381 8/24 (33%)
leucine-rich repeat 164..189 CDD:275381 5/24 (21%)
leucine-rich repeat 190..208 CDD:275381 3/17 (18%)
AMN1 <244..358 CDD:187754 28/119 (24%)
leucine-rich repeat 252..277 CDD:275381 4/24 (17%)
leucine-rich repeat 278..303 CDD:275381 9/24 (38%)
leucine-rich repeat 304..353 CDD:275381 9/49 (18%)
leucine-rich repeat 354..381 CDD:275381 9/27 (33%)
leucine-rich repeat 382..431 CDD:275381 5/17 (29%)
leucine-rich repeat 432..469 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.